BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000249-TA|BGIBMGA000249-PA|IPR000618|Insect cuticle protein (178 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT010217-1|AAQ23535.1| 194|Drosophila melanogaster RH05746p pro... 77 1e-14 AE014296-370|AAF47579.2| 194|Drosophila melanogaster CG13935-PA... 77 1e-14 AY061158-1|AAL28706.1| 180|Drosophila melanogaster LD12613p pro... 66 3e-11 AE014296-371|AAF47580.1| 180|Drosophila melanogaster CG1919-PA ... 66 3e-11 BT024400-1|ABC86462.1| 162|Drosophila melanogaster IP05056p pro... 62 3e-10 BT016066-1|AAV36951.1| 138|Drosophila melanogaster LP12967p pro... 62 3e-10 AE014296-1423|AAF50442.1| 162|Drosophila melanogaster CG7076-PA... 62 3e-10 AE014296-1422|AAF50443.2| 407|Drosophila melanogaster CG7072-PA... 62 4e-10 BT022412-1|AAY54828.1| 424|Drosophila melanogaster IP11572p pro... 55 6e-08 BT022352-1|AAY54768.1| 424|Drosophila melanogaster IP11272p pro... 55 6e-08 BT022288-1|AAY54704.1| 424|Drosophila melanogaster IP11372p pro... 55 6e-08 BT022236-1|AAY54652.1| 424|Drosophila melanogaster IP11472p pro... 55 6e-08 AE014296-3164|AAF49151.1| 401|Drosophila melanogaster CG9295-PB... 55 6e-08 Y18453-1|CAA77177.1| 472|Drosophila melanogaster drosocrystalli... 53 2e-07 BT023126-1|AAY55542.1| 245|Drosophila melanogaster IP08764p pro... 53 2e-07 BT023042-1|AAY55458.1| 245|Drosophila melanogaster IP08564p pro... 53 2e-07 AY119178-1|AAM51038.1| 477|Drosophila melanogaster RH66281p pro... 53 2e-07 AE014297-2676|AAF55678.2| 245|Drosophila melanogaster CG6240-PA... 53 2e-07 AE014134-2114|AAF53134.2| 477|Drosophila melanogaster CG16963-P... 53 2e-07 BT022677-1|AAY55093.1| 202|Drosophila melanogaster IP07124p pro... 53 3e-07 AE014296-794|AAF47863.1| 188|Drosophila melanogaster CG15008-PA... 53 3e-07 AY070590-1|AAL48061.1| 247|Drosophila melanogaster RE69226p pro... 52 6e-07 AE014296-795|AAF47864.2| 247|Drosophila melanogaster CG1259-PB ... 52 6e-07 BT022990-1|AAY55406.1| 155|Drosophila melanogaster IP08464p pro... 51 1e-06 AY071302-1|AAL48924.1| 302|Drosophila melanogaster RE33041p pro... 50 1e-06 AE014134-486|AAF51198.2| 302|Drosophila melanogaster CG2973-PA ... 50 1e-06 AY070633-1|AAL48104.1| 192|Drosophila melanogaster RH01578p pro... 50 2e-06 AE014296-792|AAF47861.1| 192|Drosophila melanogaster CG15006-PA... 50 2e-06 BT022916-1|AAY55332.1| 136|Drosophila melanogaster IP04416p pro... 48 7e-06 AE014296-793|AAF47862.1| 147|Drosophila melanogaster CG15007-PA... 48 7e-06 AY070951-1|AAL48573.1| 208|Drosophila melanogaster RE04882p pro... 48 1e-05 AE014297-499|AAF54094.1| 208|Drosophila melanogaster CG1330-PA ... 48 1e-05 AE014134-1731|AAN10713.1| 146|Drosophila melanogaster CG31876-P... 48 1e-05 AE001572-17|AAD19807.1| 208|Drosophila melanogaster cuticle pro... 48 1e-05 AE014298-801|AAF46087.1| 145|Drosophila melanogaster CG4052-PA ... 47 1e-05 AE014296-3163|AAF49152.1| 198|Drosophila melanogaster CG9290-PA... 47 1e-05 AY070676-1|AAL48147.1| 221|Drosophila melanogaster RH13984p pro... 47 2e-05 AE014297-502|AAF54091.1| 221|Drosophila melanogaster CG1252-PA ... 47 2e-05 AE014297-500|AAF54093.1| 199|Drosophila melanogaster CG2341-PA ... 47 2e-05 AE001572-16|AAD19806.1| 199|Drosophila melanogaster cuticle pro... 47 2e-05 AE001572-14|AAD19804.1| 221|Drosophila melanogaster cuticle pro... 47 2e-05 AE014134-1730|AAN10712.1| 146|Drosophila melanogaster CG31878-P... 46 3e-05 AE014134-1729|AAN10711.1| 106|Drosophila melanogaster CG31878-P... 46 3e-05 M71249-1|AAA28501.1| 188|Drosophila melanogaster cuticle protei... 45 5e-05 AE014297-496|AAF54097.2| 188|Drosophila melanogaster CG2345-PA ... 45 5e-05 AE001572-20|AAD19810.1| 188|Drosophila melanogaster pupal-cutic... 45 5e-05 AE014297-501|AAF54092.1| 217|Drosophila melanogaster CG1327-PA ... 45 7e-05 AE001572-15|AAD19805.1| 217|Drosophila melanogaster cuticle pro... 45 7e-05 BT011451-1|AAR99109.1| 340|Drosophila melanogaster RE37955p pro... 44 9e-05 BT011017-1|AAR30177.1| 205|Drosophila melanogaster RH14104p pro... 44 9e-05 AY121656-1|AAM51983.1| 206|Drosophila melanogaster RE04513p pro... 44 9e-05 AE014297-503|AAF54090.1| 205|Drosophila melanogaster CG2360-PA ... 44 9e-05 AE014297-497|AAF54096.1| 191|Drosophila melanogaster CG2342-PA ... 44 9e-05 AE014134-1758|AAN10718.1| 340|Drosophila melanogaster CG33302-P... 44 9e-05 AE001572-19|AAD19809.1| 191|Drosophila melanogaster cuticle pro... 44 9e-05 AE001572-13|AAD19803.1| 205|Drosophila melanogaster cuticle pro... 44 9e-05 AE014296-3165|AAF49150.3| 1242|Drosophila melanogaster CG9299-PA... 43 2e-04 AE014297-498|AAF54095.1| 151|Drosophila melanogaster CG1331-PA ... 43 3e-04 AE001572-18|AAD19808.1| 151|Drosophila melanogaster cuticle pro... 43 3e-04 BT024343-1|ABC86405.1| 266|Drosophila melanogaster IP09562p pro... 42 4e-04 AE014296-1421|AAF50444.1| 266|Drosophila melanogaster CG13670-P... 42 4e-04 AE014297-2840|AAF55794.1| 381|Drosophila melanogaster CG5494-PA... 40 0.001 AY071527-1|AAL49149.1| 270|Drosophila melanogaster RE57183p pro... 40 0.003 AE014296-1500|AAF50383.2| 270|Drosophila melanogaster CG32029-P... 40 0.003 AM294620-1|CAL26618.1| 204|Drosophila melanogaster CG9283 protein. 39 0.004 AM294619-1|CAL26617.1| 204|Drosophila melanogaster CG9283 protein. 39 0.004 AM294618-1|CAL26616.1| 204|Drosophila melanogaster CG9283 protein. 39 0.004 AM294617-1|CAL26615.1| 204|Drosophila melanogaster CG9283 protein. 39 0.004 AM294616-1|CAL26614.1| 204|Drosophila melanogaster CG9283 protein. 39 0.004 AM294614-1|CAL26612.1| 204|Drosophila melanogaster CG9283 protein. 39 0.004 AM294613-1|CAL26611.1| 204|Drosophila melanogaster CG9283 protein. 39 0.004 AM294612-1|CAL26610.1| 204|Drosophila melanogaster CG9283 protein. 39 0.004 AM294611-1|CAL26609.1| 204|Drosophila melanogaster CG9283 protein. 39 0.004 AM294610-1|CAL26608.1| 204|Drosophila melanogaster CG9283 protein. 39 0.004 AM294609-1|CAL26607.1| 204|Drosophila melanogaster CG9283 protein. 39 0.004 AE014296-3162|AAF49153.1| 204|Drosophila melanogaster CG9283-PA... 39 0.004 AE014134-2498|AAF53397.1| 218|Drosophila melanogaster CG3474-PA... 36 0.024 AM294615-1|CAL26613.1| 204|Drosophila melanogaster CG9283 protein. 35 0.055 AE014134-1650|AAF52783.2| 153|Drosophila melanogaster CG3818-PA... 34 0.13 AY071448-1|AAL49070.1| 815|Drosophila melanogaster RE53044p pro... 33 0.17 AE013599-1762|AAF58339.2| 815|Drosophila melanogaster CG13338-P... 33 0.17 AY051482-1|AAK92906.1| 497|Drosophila melanogaster GH14349p pro... 33 0.22 AE014296-2840|AAF49390.3| 497|Drosophila melanogaster CG9665-PA... 33 0.22 BT029031-1|ABJ16964.1| 184|Drosophila melanogaster IP02265p pro... 33 0.29 AY047580-1|AAK77312.1| 184|Drosophila melanogaster GH09112p pro... 33 0.29 AE013599-3027|AAF57459.1| 184|Drosophila melanogaster CG18066-P... 33 0.29 AY060758-1|AAL28306.1| 178|Drosophila melanogaster GH20904p pro... 32 0.39 AE013599-1764|AAF58336.1| 178|Drosophila melanogaster CG6305-PA... 32 0.39 AY069040-1|AAL39185.1| 429|Drosophila melanogaster GH03623p pro... 32 0.51 AE014296-2717|AAF49476.1| 429|Drosophila melanogaster CG4784-PA... 32 0.51 BT029065-1|ABJ16998.1| 175|Drosophila melanogaster IP07570p pro... 30 1.6 AE013599-1482|AAF58515.1| 190|Drosophila melanogaster CG8515-PA... 30 1.6 BT016139-1|AAV37024.1| 587|Drosophila melanogaster AT30209p pro... 30 2.1 AE014134-2709|AAF53528.3| 263|Drosophila melanogaster CG31737-P... 30 2.1 BT023021-1|AAY55437.1| 133|Drosophila melanogaster IP04071p pro... 29 2.7 AM294630-1|CAL26628.1| 143|Drosophila melanogaster CG13934 prot... 29 2.7 AM294629-1|CAL26627.1| 143|Drosophila melanogaster CG13934 prot... 29 2.7 AM294628-1|CAL26626.1| 143|Drosophila melanogaster CG13934 prot... 29 2.7 AM294627-1|CAL26625.1| 143|Drosophila melanogaster CG13934 prot... 29 2.7 AM294626-1|CAL26624.1| 143|Drosophila melanogaster CG13934 prot... 29 2.7 AM294625-1|CAL26623.1| 143|Drosophila melanogaster CG13934 prot... 29 2.7 AM294624-1|CAL26622.1| 143|Drosophila melanogaster CG13934 prot... 29 2.7 AM294623-1|CAL26621.1| 143|Drosophila melanogaster CG13934 prot... 29 2.7 AM294622-1|CAL26620.1| 143|Drosophila melanogaster CG13934 prot... 29 2.7 AM294621-1|CAL26619.1| 143|Drosophila melanogaster CG13934 prot... 29 2.7 AE014296-369|AAF47578.1| 143|Drosophila melanogaster CG13934-PA... 29 2.7 AY070569-1|AAL48040.1| 241|Drosophila melanogaster RE11283p pro... 29 3.6 AE014297-4671|AAF57092.1| 241|Drosophila melanogaster CG12045-P... 29 3.6 BT024398-1|ABC86460.1| 150|Drosophila melanogaster IP05065p pro... 28 6.3 AY060775-1|AAL28323.1| 197|Drosophila melanogaster GH23965p pro... 28 6.3 AE014298-1778|AAF48172.1| 197|Drosophila melanogaster CG2555-PA... 28 6.3 AE013599-1477|AAF58517.1| 126|Drosophila melanogaster CG8510-PA... 28 6.3 AE013599-1472|AAF58520.1| 166|Drosophila melanogaster CG8836-PA... 28 6.3 AE013599-1237|AAF58694.1| 135|Drosophila melanogaster CG9079-PA... 28 6.3 AE014296-2716|AAF49477.1| 217|Drosophila melanogaster CG12255-P... 28 8.3 AE014134-2321|AAF53275.1| 1413|Drosophila melanogaster CG6108-PA... 28 8.3 >BT010217-1|AAQ23535.1| 194|Drosophila melanogaster RH05746p protein. Length = 194 Score = 77.4 bits (182), Expect = 1e-14 Identities = 33/37 (89%), Positives = 36/37 (97%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 GQYSLVEPDGS+RTVDYTADS+HGFNAVV+KSGP VH Sbjct: 63 GQYSLVEPDGSIRTVDYTADSIHGFNAVVTKSGPTVH 99 >AE014296-370|AAF47579.2| 194|Drosophila melanogaster CG13935-PA protein. Length = 194 Score = 77.4 bits (182), Expect = 1e-14 Identities = 33/37 (89%), Positives = 36/37 (97%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 GQYSLVEPDGS+RTVDYTADS+HGFNAVV+KSGP VH Sbjct: 63 GQYSLVEPDGSIRTVDYTADSIHGFNAVVTKSGPTVH 99 >AY061158-1|AAL28706.1| 180|Drosophila melanogaster LD12613p protein. Length = 180 Score = 65.7 bits (153), Expect = 3e-11 Identities = 29/37 (78%), Positives = 32/37 (86%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G YSLVEPDGSVRTV+YTAD +GFNAVV K+GP VH Sbjct: 82 GSYSLVEPDGSVRTVEYTADDHNGFNAVVHKTGPTVH 118 >AE014296-371|AAF47580.1| 180|Drosophila melanogaster CG1919-PA protein. Length = 180 Score = 65.7 bits (153), Expect = 3e-11 Identities = 29/37 (78%), Positives = 32/37 (86%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G YSLVEPDGSVRTV+YTAD +GFNAVV K+GP VH Sbjct: 82 GSYSLVEPDGSVRTVEYTADDHNGFNAVVHKTGPTVH 118 >BT024400-1|ABC86462.1| 162|Drosophila melanogaster IP05056p protein. Length = 162 Score = 62.5 bits (145), Expect = 3e-10 Identities = 28/37 (75%), Positives = 31/37 (83%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 GQYSLVEPDGS+RTVDYTAD +GFNAVV K+ P H Sbjct: 117 GQYSLVEPDGSIRTVDYTADKHNGFNAVVHKTAPVHH 153 >BT016066-1|AAV36951.1| 138|Drosophila melanogaster LP12967p protein. Length = 138 Score = 62.5 bits (145), Expect = 3e-10 Identities = 28/35 (80%), Positives = 31/35 (88%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPN 38 GQYSLVEPDGSVRTVDYTAD +GFNAVV K+ P+ Sbjct: 80 GQYSLVEPDGSVRTVDYTADDHNGFNAVVHKTAPS 114 >AE014296-1423|AAF50442.1| 162|Drosophila melanogaster CG7076-PA protein. Length = 162 Score = 62.5 bits (145), Expect = 3e-10 Identities = 28/37 (75%), Positives = 31/37 (83%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 GQYSLVEPDGS+RTVDYTAD +GFNAVV K+ P H Sbjct: 117 GQYSLVEPDGSIRTVDYTADKHNGFNAVVHKTAPVHH 153 >AE014296-1422|AAF50443.2| 407|Drosophila melanogaster CG7072-PA protein. Length = 407 Score = 62.1 bits (144), Expect = 4e-10 Identities = 28/34 (82%), Positives = 30/34 (88%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGP 37 GQYSLVEPDGSVRTVDYTAD +GFNAVV K+ P Sbjct: 119 GQYSLVEPDGSVRTVDYTADDHNGFNAVVHKTAP 152 >BT022412-1|AAY54828.1| 424|Drosophila melanogaster IP11572p protein. Length = 424 Score = 54.8 bits (126), Expect = 6e-08 Identities = 23/37 (62%), Positives = 28/37 (75%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G YS++EPDGS+RTV YTAD+ GFNA+V G N H Sbjct: 84 GHYSVLEPDGSIRTVHYTADAKKGFNAIVKTVGANSH 120 >BT022352-1|AAY54768.1| 424|Drosophila melanogaster IP11272p protein. Length = 424 Score = 54.8 bits (126), Expect = 6e-08 Identities = 23/37 (62%), Positives = 28/37 (75%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G YS++EPDGS+RTV YTAD+ GFNA+V G N H Sbjct: 84 GHYSVLEPDGSIRTVHYTADAKKGFNAIVKTVGANSH 120 >BT022288-1|AAY54704.1| 424|Drosophila melanogaster IP11372p protein. Length = 424 Score = 54.8 bits (126), Expect = 6e-08 Identities = 23/37 (62%), Positives = 28/37 (75%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G YS++EPDGS+RTV YTAD+ GFNA+V G N H Sbjct: 84 GHYSVLEPDGSIRTVHYTADAKKGFNAIVKTVGANSH 120 >BT022236-1|AAY54652.1| 424|Drosophila melanogaster IP11472p protein. Length = 424 Score = 54.8 bits (126), Expect = 6e-08 Identities = 23/37 (62%), Positives = 28/37 (75%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G YS++EPDGS+RTV YTAD+ GFNA+V G N H Sbjct: 84 GHYSVLEPDGSIRTVHYTADAKKGFNAIVKTVGANSH 120 >AE014296-3164|AAF49151.1| 401|Drosophila melanogaster CG9295-PB protein. Length = 401 Score = 54.8 bits (126), Expect = 6e-08 Identities = 23/37 (62%), Positives = 28/37 (75%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G YS++EPDGS+RTV YTAD+ GFNA+V G N H Sbjct: 61 GHYSVLEPDGSIRTVHYTADAKKGFNAIVKTVGANSH 97 >Y18453-1|CAA77177.1| 472|Drosophila melanogaster drosocrystallin protein. Length = 472 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/34 (64%), Positives = 29/34 (85%) Query: 1 MLLGQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 ++ GQYSL+EPDG+ R V+YTAD + GFNA+VSK Sbjct: 102 LVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVSK 135 >BT023126-1|AAY55542.1| 245|Drosophila melanogaster IP08764p protein. Length = 245 Score = 53.2 bits (122), Expect = 2e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G YS+V+PDG+ RTVDYTAD HGFNAVV K Sbjct: 96 GSYSVVDPDGTKRTVDYTADPHHGFNAVVRK 126 >BT023042-1|AAY55458.1| 245|Drosophila melanogaster IP08564p protein. Length = 245 Score = 53.2 bits (122), Expect = 2e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G YS+V+PDG+ RTVDYTAD HGFNAVV K Sbjct: 96 GSYSVVDPDGTKRTVDYTADPHHGFNAVVRK 126 >AY119178-1|AAM51038.1| 477|Drosophila melanogaster RH66281p protein. Length = 477 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/34 (64%), Positives = 29/34 (85%) Query: 1 MLLGQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 ++ GQYSL+EPDG+ R V+YTAD + GFNA+VSK Sbjct: 102 LVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVSK 135 >AE014297-2676|AAF55678.2| 245|Drosophila melanogaster CG6240-PA protein. Length = 245 Score = 53.2 bits (122), Expect = 2e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G YS+V+PDG+ RTVDYTAD HGFNAVV K Sbjct: 96 GSYSVVDPDGTKRTVDYTADPHHGFNAVVRK 126 >AE014134-2114|AAF53134.2| 477|Drosophila melanogaster CG16963-PA protein. Length = 477 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/34 (64%), Positives = 29/34 (85%) Query: 1 MLLGQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 ++ GQYSL+EPDG+ R V+YTAD + GFNA+VSK Sbjct: 102 LVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVSK 135 >BT022677-1|AAY55093.1| 202|Drosophila melanogaster IP07124p protein. Length = 202 Score = 52.8 bits (121), Expect = 3e-07 Identities = 22/33 (66%), Positives = 26/33 (78%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSG 36 G YSL EPDG++R V YTAD ++GFNAVV K G Sbjct: 134 GSYSLAEPDGTIRKVTYTADKVNGFNAVVEKKG 166 >AE014296-794|AAF47863.1| 188|Drosophila melanogaster CG15008-PA protein. Length = 188 Score = 52.8 bits (121), Expect = 3e-07 Identities = 22/33 (66%), Positives = 26/33 (78%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSG 36 G YSL EPDG++R V YTAD ++GFNAVV K G Sbjct: 120 GSYSLAEPDGTIRKVTYTADKVNGFNAVVEKKG 152 >AY070590-1|AAL48061.1| 247|Drosophila melanogaster RE69226p protein. Length = 247 Score = 51.6 bits (118), Expect = 6e-07 Identities = 23/34 (67%), Positives = 26/34 (76%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGP 37 G YSL+EPDGS R V Y ADS++GFNAVV K P Sbjct: 174 GSYSLIEPDGSRRIVSYYADSINGFNAVVQKDVP 207 >AE014296-795|AAF47864.2| 247|Drosophila melanogaster CG1259-PB protein. Length = 247 Score = 51.6 bits (118), Expect = 6e-07 Identities = 23/34 (67%), Positives = 26/34 (76%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGP 37 G YSL+EPDGS R V Y ADS++GFNAVV K P Sbjct: 174 GSYSLIEPDGSRRIVSYYADSINGFNAVVQKDVP 207 >BT022990-1|AAY55406.1| 155|Drosophila melanogaster IP08464p protein. Length = 155 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/29 (75%), Positives = 25/29 (86%) Query: 6 YSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 YS+V+PDG+ RTVDYTAD HGFNAVV K Sbjct: 8 YSVVDPDGTKRTVDYTADPHHGFNAVVRK 36 >AY071302-1|AAL48924.1| 302|Drosophila melanogaster RE33041p protein. Length = 302 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/31 (67%), Positives = 26/31 (83%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G YSL++PDG RTV YTAD +HGFNAVV++ Sbjct: 185 GFYSLIDPDGYKRTVTYTADDVHGFNAVVNR 215 >AE014134-486|AAF51198.2| 302|Drosophila melanogaster CG2973-PA protein. Length = 302 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/31 (67%), Positives = 26/31 (83%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G YSL++PDG RTV YTAD +HGFNAVV++ Sbjct: 185 GFYSLIDPDGYKRTVTYTADDVHGFNAVVNR 215 >AY070633-1|AAL48104.1| 192|Drosophila melanogaster RH01578p protein. Length = 192 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSG 36 G YSL+E DG+ R V+YTAD +HGFNAVV + G Sbjct: 88 GAYSLIEADGTRRIVEYTADPVHGFNAVVRREG 120 >AE014296-792|AAF47861.1| 192|Drosophila melanogaster CG15006-PA protein. Length = 192 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSG 36 G YSL+E DG+ R V+YTAD +HGFNAVV + G Sbjct: 88 GAYSLIEADGTRRIVEYTADPVHGFNAVVRREG 120 >BT022916-1|AAY55332.1| 136|Drosophila melanogaster IP04416p protein. Length = 136 Score = 48.0 bits (109), Expect = 7e-06 Identities = 22/34 (64%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGP 37 G YS+V+ DGS+RTV YTAD ++GFNAVV + GP Sbjct: 86 GSYSVVDADGSLRTVFYTADPINGFNAVVQR-GP 118 >AE014296-793|AAF47862.1| 147|Drosophila melanogaster CG15007-PA protein. Length = 147 Score = 48.0 bits (109), Expect = 7e-06 Identities = 22/34 (64%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGP 37 G YS+V+ DGS+RTV YTAD ++GFNAVV + GP Sbjct: 97 GSYSVVDADGSLRTVFYTADPINGFNAVVQR-GP 129 >AY070951-1|AAL48573.1| 208|Drosophila melanogaster RE04882p protein. Length = 208 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/31 (64%), Positives = 26/31 (83%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G+YSL++ DG RTV YTADS++GFNAVV + Sbjct: 79 GEYSLIDADGFKRTVTYTADSINGFNAVVRR 109 >AE014297-499|AAF54094.1| 208|Drosophila melanogaster CG1330-PA protein. Length = 208 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/31 (64%), Positives = 26/31 (83%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G+YSL++ DG RTV YTADS++GFNAVV + Sbjct: 79 GEYSLIDADGFKRTVTYTADSINGFNAVVRR 109 >AE014134-1731|AAN10713.1| 146|Drosophila melanogaster CG31876-PA protein. Length = 146 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/31 (64%), Positives = 27/31 (87%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQY+LV+ DG +RTVDYT+D+ +GFNAVV + Sbjct: 73 GQYTLVDADGYLRTVDYTSDAHNGFNAVVRR 103 >AE001572-17|AAD19807.1| 208|Drosophila melanogaster cuticle protein protein. Length = 208 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/31 (64%), Positives = 26/31 (83%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G+YSL++ DG RTV YTADS++GFNAVV + Sbjct: 79 GEYSLIDADGFKRTVTYTADSINGFNAVVRR 109 >AE014298-801|AAF46087.1| 145|Drosophila melanogaster CG4052-PA protein. Length = 145 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/31 (64%), Positives = 26/31 (83%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G+YSLV+ DG RTV YTAD ++GFNAVV++ Sbjct: 92 GEYSLVDSDGFKRTVQYTADPINGFNAVVNR 122 >AE014296-3163|AAF49152.1| 198|Drosophila melanogaster CG9290-PA protein. Length = 198 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/37 (59%), Positives = 25/37 (67%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G YSL E DG+ R V+YTAD +GFNAVV K G H Sbjct: 114 GSYSLKESDGTTRVVEYTADDHNGFNAVVKKLGHAHH 150 >AY070676-1|AAL48147.1| 221|Drosophila melanogaster RH13984p protein. Length = 221 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/31 (61%), Positives = 26/31 (83%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G+YSL++ DG RTV YTAD ++GFNAVV++ Sbjct: 90 GEYSLIDADGYKRTVQYTADPINGFNAVVNR 120 >AE014297-502|AAF54091.1| 221|Drosophila melanogaster CG1252-PA protein. Length = 221 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/31 (61%), Positives = 26/31 (83%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G+YSL++ DG RTV YTAD ++GFNAVV++ Sbjct: 90 GEYSLIDADGYKRTVQYTADPINGFNAVVNR 120 >AE014297-500|AAF54093.1| 199|Drosophila melanogaster CG2341-PA protein. Length = 199 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/31 (61%), Positives = 26/31 (83%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G+YSL++ DG RTV YTAD ++GFNAVV++ Sbjct: 90 GEYSLIDADGYKRTVQYTADPINGFNAVVNR 120 >AE001572-16|AAD19806.1| 199|Drosophila melanogaster cuticle protein protein. Length = 199 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/31 (61%), Positives = 26/31 (83%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G+YSL++ DG RTV YTAD ++GFNAVV++ Sbjct: 90 GEYSLIDADGYKRTVQYTADPINGFNAVVNR 120 >AE001572-14|AAD19804.1| 221|Drosophila melanogaster cuticle protein protein. Length = 221 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/31 (61%), Positives = 26/31 (83%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G+YSL++ DG RTV YTAD ++GFNAVV++ Sbjct: 90 GEYSLIDADGYKRTVQYTADPINGFNAVVNR 120 >AE014134-1730|AAN10712.1| 146|Drosophila melanogaster CG31878-PA, isoform A protein. Length = 146 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/31 (67%), Positives = 24/31 (77%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G+YSLV+PDG R VDYTAD L GFNA V + Sbjct: 110 GRYSLVDPDGHRRIVDYTADPLLGFNAQVRR 140 >AE014134-1729|AAN10711.1| 106|Drosophila melanogaster CG31878-PB, isoform B protein. Length = 106 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/31 (67%), Positives = 24/31 (77%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G+YSLV+PDG R VDYTAD L GFNA V + Sbjct: 70 GRYSLVDPDGHRRIVDYTADPLLGFNAQVRR 100 >M71249-1|AAA28501.1| 188|Drosophila melanogaster cuticle protein protein. Length = 188 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/31 (64%), Positives = 24/31 (77%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQYS+ + DG RTVDYTAD + GFNAVV + Sbjct: 65 GQYSVNDADGYRRTVDYTADDVRGFNAVVRR 95 >AE014297-496|AAF54097.2| 188|Drosophila melanogaster CG2345-PA protein. Length = 188 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/31 (64%), Positives = 24/31 (77%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQYS+ + DG RTVDYTAD + GFNAVV + Sbjct: 65 GQYSVNDADGYRRTVDYTADDVRGFNAVVRR 95 >AE001572-20|AAD19810.1| 188|Drosophila melanogaster pupal-cuticle-protein protein. Length = 188 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/31 (64%), Positives = 24/31 (77%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQYS+ + DG RTVDYTAD + GFNAVV + Sbjct: 65 GQYSVNDADGYRRTVDYTADDVRGFNAVVRR 95 >AE014297-501|AAF54092.1| 217|Drosophila melanogaster CG1327-PA protein. Length = 217 Score = 44.8 bits (101), Expect = 7e-05 Identities = 22/37 (59%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G+YSL + DG RTV YTADS++GFNAVV + P H Sbjct: 93 GEYSLDDADGFRRTVKYTADSVNGFNAVVHRE-PLAH 128 >AE001572-15|AAD19805.1| 217|Drosophila melanogaster cuticle protein protein. Length = 217 Score = 44.8 bits (101), Expect = 7e-05 Identities = 22/37 (59%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G+YSL + DG RTV YTADS++GFNAVV + P H Sbjct: 93 GEYSLDDADGFRRTVKYTADSVNGFNAVVHRE-PLAH 128 >BT011451-1|AAR99109.1| 340|Drosophila melanogaster RE37955p protein. Length = 340 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/33 (54%), Positives = 26/33 (78%) Query: 2 LLGQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 ++G YS+++ DG RTV YTAD ++GFNAVV + Sbjct: 161 VVGSYSVLDADGFKRTVTYTADDINGFNAVVQR 193 >BT011017-1|AAR30177.1| 205|Drosophila melanogaster RH14104p protein. Length = 205 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/31 (58%), Positives = 25/31 (80%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G+YSL++ DG R V YTAD ++GFNAVV++ Sbjct: 90 GEYSLIDADGYKRIVQYTADPINGFNAVVNR 120 >AY121656-1|AAM51983.1| 206|Drosophila melanogaster RE04513p protein. Length = 206 Score = 44.4 bits (100), Expect = 9e-05 Identities = 20/31 (64%), Positives = 24/31 (77%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQYSL + DG R VDYTAD ++GFNAVV + Sbjct: 85 GQYSLNDADGYRRIVDYTADPINGFNAVVRR 115 >AE014297-503|AAF54090.1| 205|Drosophila melanogaster CG2360-PA protein. Length = 205 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/31 (58%), Positives = 25/31 (80%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G+YSL++ DG R V YTAD ++GFNAVV++ Sbjct: 90 GEYSLIDADGYKRIVQYTADPINGFNAVVNR 120 >AE014297-497|AAF54096.1| 191|Drosophila melanogaster CG2342-PA protein. Length = 191 Score = 44.4 bits (100), Expect = 9e-05 Identities = 20/31 (64%), Positives = 24/31 (77%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQYSL + DG R VDYTAD ++GFNAVV + Sbjct: 70 GQYSLNDADGYRRIVDYTADPINGFNAVVRR 100 >AE014134-1758|AAN10718.1| 340|Drosophila melanogaster CG33302-PA protein. Length = 340 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/33 (54%), Positives = 26/33 (78%) Query: 2 LLGQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 ++G YS+++ DG RTV YTAD ++GFNAVV + Sbjct: 161 VVGSYSVLDADGFKRTVTYTADDINGFNAVVQR 193 >AE001572-19|AAD19809.1| 191|Drosophila melanogaster cuticle protein protein. Length = 191 Score = 44.4 bits (100), Expect = 9e-05 Identities = 20/31 (64%), Positives = 24/31 (77%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 GQYSL + DG R VDYTAD ++GFNAVV + Sbjct: 70 GQYSLNDADGYRRIVDYTADPINGFNAVVRR 100 >AE001572-13|AAD19803.1| 205|Drosophila melanogaster cuticle protein protein. Length = 205 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/31 (58%), Positives = 25/31 (80%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G+YSL++ DG R V YTAD ++GFNAVV++ Sbjct: 90 GEYSLIDADGYKRIVQYTADPINGFNAVVNR 120 >AE014296-3165|AAF49150.3| 1242|Drosophila melanogaster CG9299-PA protein. Length = 1242 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/32 (65%), Positives = 24/32 (75%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKS 35 G+YSLVEPDG+VRTV Y AD GF+A V S Sbjct: 1195 GEYSLVEPDGNVRTVKYYADWETGFHAEVINS 1226 >AE014297-498|AAF54095.1| 151|Drosophila melanogaster CG1331-PA protein. Length = 151 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/31 (54%), Positives = 25/31 (80%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G+YSL++ DG R V YT+D ++GFNAVV++ Sbjct: 90 GEYSLIDSDGYKRIVQYTSDPVNGFNAVVNR 120 >AE001572-18|AAD19808.1| 151|Drosophila melanogaster cuticle protein protein. Length = 151 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/31 (54%), Positives = 25/31 (80%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK 34 G+YSL++ DG R V YT+D ++GFNAVV++ Sbjct: 90 GEYSLIDSDGYKRIVQYTSDPVNGFNAVVNR 120 >BT024343-1|ABC86405.1| 266|Drosophila melanogaster IP09562p protein. Length = 266 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/33 (54%), Positives = 24/33 (72%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSG 36 G YS+V+PDG++R V YTAD +GF A V +G Sbjct: 131 GVYSVVDPDGTLRVVKYTADDANGFQAEVITNG 163 >AE014296-1421|AAF50444.1| 266|Drosophila melanogaster CG13670-PA protein. Length = 266 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/33 (54%), Positives = 24/33 (72%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSG 36 G YS+V+PDG++R V YTAD +GF A V +G Sbjct: 131 GVYSVVDPDGTLRVVKYTADDANGFQAEVITNG 163 >AE014297-2840|AAF55794.1| 381|Drosophila melanogaster CG5494-PA protein. Length = 381 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSK--SGPNVH 40 G YS V+ G V++V YTAD HGFNAV + P VH Sbjct: 60 GSYSYVDGHGHVQSVSYTADPHHGFNAVGTNLPQAPQVH 98 >AY071527-1|AAL49149.1| 270|Drosophila melanogaster RE57183p protein. Length = 270 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MLLGQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNV 39 ++ G YS+V+ DG +RTV YTAD GF A V + ++ Sbjct: 183 VIKGSYSVVDSDGFIRTVKYTADPKEGFKAEVIREPTDI 221 >AE014296-1500|AAF50383.2| 270|Drosophila melanogaster CG32029-PA protein. Length = 270 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MLLGQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNV 39 ++ G YS+V+ DG +RTV YTAD GF A V + ++ Sbjct: 183 VIKGSYSVVDSDGFIRTVKYTADPKEGFKAEVIREPTDI 221 >AM294620-1|CAL26618.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/37 (48%), Positives = 22/37 (59%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G Y++ E DG R V+YTADS +GF A V G H Sbjct: 128 GGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHASH 164 >AM294619-1|CAL26617.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/37 (48%), Positives = 22/37 (59%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G Y++ E DG R V+YTADS +GF A V G H Sbjct: 128 GGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHASH 164 >AM294618-1|CAL26616.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/37 (48%), Positives = 22/37 (59%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G Y++ E DG R V+YTADS +GF A V G H Sbjct: 128 GGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHASH 164 >AM294617-1|CAL26615.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/37 (48%), Positives = 22/37 (59%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G Y++ E DG R V+YTADS +GF A V G H Sbjct: 128 GGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHASH 164 >AM294616-1|CAL26614.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/37 (48%), Positives = 22/37 (59%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G Y++ E DG R V+YTADS +GF A V G H Sbjct: 128 GGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHASH 164 >AM294614-1|CAL26612.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/37 (48%), Positives = 22/37 (59%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G Y++ E DG R V+YTADS +GF A V G H Sbjct: 128 GGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHASH 164 >AM294613-1|CAL26611.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/37 (48%), Positives = 22/37 (59%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G Y++ E DG R V+YTADS +GF A V G H Sbjct: 128 GGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHASH 164 >AM294612-1|CAL26610.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/37 (48%), Positives = 22/37 (59%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G Y++ E DG R V+YTADS +GF A V G H Sbjct: 128 GGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHASH 164 >AM294611-1|CAL26609.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/37 (48%), Positives = 22/37 (59%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G Y++ E DG R V+YTADS +GF A V G H Sbjct: 128 GGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHASH 164 >AM294610-1|CAL26608.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/37 (48%), Positives = 22/37 (59%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G Y++ E DG R V+YTADS +GF A V G H Sbjct: 128 GGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHASH 164 >AM294609-1|CAL26607.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/37 (48%), Positives = 22/37 (59%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G Y++ E DG R V+YTADS +GF A V G H Sbjct: 128 GGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHASH 164 >AE014296-3162|AAF49153.1| 204|Drosophila melanogaster CG9283-PA protein. Length = 204 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/37 (48%), Positives = 22/37 (59%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G Y++ E DG R V+YTADS +GF A V G H Sbjct: 128 GGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHASH 164 >AE014134-2498|AAF53397.1| 218|Drosophila melanogaster CG3474-PA protein. Length = 218 Score = 36.3 bits (80), Expect = 0.024 Identities = 17/37 (45%), Positives = 21/37 (56%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G Y L++ DG RTV YTAD GF A V + + H Sbjct: 100 GHYELIDADGHKRTVHYTADKHKGFEAHVHREKLHDH 136 >AM294615-1|CAL26613.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 35.1 bits (77), Expect = 0.055 Identities = 17/37 (45%), Positives = 21/37 (56%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 G Y++ E DG R V+YTA S +GF A V G H Sbjct: 128 GGYTMKEADGRTRIVEYTAYSHNGFQATVKHVGHASH 164 >AE014134-1650|AAF52783.2| 153|Drosophila melanogaster CG3818-PA protein. Length = 153 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/36 (38%), Positives = 21/36 (58%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNV 39 G Y L++ DG R V Y AD +GF A+V + ++ Sbjct: 61 GVYELIDSDGYRRIVQYKADDHNGFEAIVQREPTDI 96 >AY071448-1|AAL49070.1| 815|Drosophila melanogaster RE53044p protein. Length = 815 Score = 33.5 bits (73), Expect = 0.17 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 GQY ++ PDG ++ V Y AD GF+A VS G H Sbjct: 780 GQYHILLPDGRIQNVIYHADDT-GFHADVSFEGATKH 815 >AE013599-1762|AAF58339.2| 815|Drosophila melanogaster CG13338-PA protein. Length = 815 Score = 33.5 bits (73), Expect = 0.17 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 GQY ++ PDG ++ V Y AD GF+A VS G H Sbjct: 780 GQYHILLPDGRIQNVIYHADDT-GFHADVSFEGATKH 815 >AY051482-1|AAK92906.1| 497|Drosophila melanogaster GH14349p protein. Length = 497 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/40 (35%), Positives = 23/40 (57%) Query: 1 MLLGQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 ++ G YS ++ G RTV+Y A + G+ V ++ GP H Sbjct: 134 LVRGTYSFLDDKGVQRTVEYIAGAGIGYRVVQNRIGPGTH 173 >AE014296-2840|AAF49390.3| 497|Drosophila melanogaster CG9665-PA protein. Length = 497 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/40 (35%), Positives = 23/40 (57%) Query: 1 MLLGQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPNVH 40 ++ G YS ++ G RTV+Y A + G+ V ++ GP H Sbjct: 134 LVRGTYSFLDDKGVQRTVEYIAGAGIGYRVVQNRIGPGTH 173 >BT029031-1|ABJ16964.1| 184|Drosophila melanogaster IP02265p protein. Length = 184 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MLLGQYSLVEPDGSVRTVDYTADSLHGFNAVVS 33 ++ G +S V+P VRTV Y AD HGF+ +S Sbjct: 58 VIRGAFSYVDPKNQVRTVQYVADE-HGFHPQLS 89 >AY047580-1|AAK77312.1| 184|Drosophila melanogaster GH09112p protein. Length = 184 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MLLGQYSLVEPDGSVRTVDYTADSLHGFNAVVS 33 ++ G +S V+P VRTV Y AD HGF+ +S Sbjct: 58 VIRGAFSYVDPKNQVRTVQYVADE-HGFHPQLS 89 >AE013599-3027|AAF57459.1| 184|Drosophila melanogaster CG18066-PA protein. Length = 184 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MLLGQYSLVEPDGSVRTVDYTADSLHGFNAVVS 33 ++ G +S V+P VRTV Y AD HGF+ +S Sbjct: 58 VIRGAFSYVDPKNQVRTVQYVADE-HGFHPQLS 89 >AY060758-1|AAL28306.1| 178|Drosophila melanogaster GH20904p protein. Length = 178 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/36 (41%), Positives = 22/36 (61%) Query: 1 MLLGQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSG 36 ++ G+Y + PDG + V YTAD G++A VS G Sbjct: 115 VVTGEYRVQMPDGRTQIVRYTADWKTGYHADVSYEG 150 >AE013599-1764|AAF58336.1| 178|Drosophila melanogaster CG6305-PA protein. Length = 178 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/36 (41%), Positives = 22/36 (61%) Query: 1 MLLGQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSG 36 ++ G+Y + PDG + V YTAD G++A VS G Sbjct: 115 VVTGEYRVQMPDGRTQIVRYTADWKTGYHADVSYEG 150 >AY069040-1|AAL39185.1| 429|Drosophila melanogaster GH03623p protein. Length = 429 Score = 31.9 bits (69), Expect = 0.51 Identities = 14/30 (46%), Positives = 19/30 (63%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVS 33 G YS V+ DG ++TV Y A+ + GF A S Sbjct: 62 GFYSYVDADGKLQTVRYEANGVQGFKAEAS 91 >AE014296-2717|AAF49476.1| 429|Drosophila melanogaster CG4784-PA protein. Length = 429 Score = 31.9 bits (69), Expect = 0.51 Identities = 14/30 (46%), Positives = 19/30 (63%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVS 33 G YS V+ DG ++TV Y A+ + GF A S Sbjct: 62 GFYSYVDADGKLQTVRYEANGVQGFKAEAS 91 >BT029065-1|ABJ16998.1| 175|Drosophila melanogaster IP07570p protein. Length = 175 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNA 30 GQYS P+G++ V YTAD +GF A Sbjct: 84 GQYSYQSPEGTLVNVQYTADE-NGFRA 109 >AE013599-1482|AAF58515.1| 190|Drosophila melanogaster CG8515-PA protein. Length = 190 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNA 30 GQYS P+G++ V YTAD +GF A Sbjct: 99 GQYSYQSPEGTLVNVQYTADE-NGFRA 124 >BT016139-1|AAV37024.1| 587|Drosophila melanogaster AT30209p protein. Length = 587 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Query: 139 PQVYPSPGPLTYPKFGPTPFP 159 P+ YP PGP YP GP +P Sbjct: 183 PRGYPGPGPRGYPGRGPRGYP 203 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Query: 139 PQVYPSPGPLTYPKFGPTPFP 159 P+ YP PGP YP GP +P Sbjct: 167 PRGYPGPGPRGYPGPGPRGYP 187 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Query: 139 PQVYPSPGPLTYPKFGPTPFP 159 P+ YP PGP YP GP +P Sbjct: 175 PRGYPGPGPRGYPGPGPRGYP 195 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Query: 139 PQVYPSPGPLTYPKFGPTPFP 159 P+ YP PGP YP GP +P Sbjct: 199 PRGYPGPGPRGYPGPGPRGYP 219 >AE014134-2709|AAF53528.3| 263|Drosophila melanogaster CG31737-PA protein. Length = 263 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Query: 139 PQVYPSPGPLTYPKFGPTPFP 159 P+ YP PGP YP GP +P Sbjct: 175 PRGYPGPGPRGYPGRGPRGYP 195 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Query: 139 PQVYPSPGPLTYPKFGPTPFP 159 P+ YP PGP YP GP +P Sbjct: 167 PRGYPGPGPRGYPGPGPRGYP 187 >BT023021-1|AAY55437.1| 133|Drosophila melanogaster IP04071p protein. Length = 133 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLH-GFNAVVSKSGPN 38 G YS +EP G +R+V Y + GF AVV + N Sbjct: 70 GSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGN 105 >AM294630-1|CAL26628.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLH-GFNAVVSKSGPN 38 G YS +EP G +R+V Y + GF AVV + N Sbjct: 80 GSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGN 115 >AM294629-1|CAL26627.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLH-GFNAVVSKSGPN 38 G YS +EP G +R+V Y + GF AVV + N Sbjct: 80 GSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGN 115 >AM294628-1|CAL26626.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLH-GFNAVVSKSGPN 38 G YS +EP G +R+V Y + GF AVV + N Sbjct: 80 GSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGN 115 >AM294627-1|CAL26625.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLH-GFNAVVSKSGPN 38 G YS +EP G +R+V Y + GF AVV + N Sbjct: 80 GSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGN 115 >AM294626-1|CAL26624.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLH-GFNAVVSKSGPN 38 G YS +EP G +R+V Y + GF AVV + N Sbjct: 80 GSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGN 115 >AM294625-1|CAL26623.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLH-GFNAVVSKSGPN 38 G YS +EP G +R+V Y + GF AVV + N Sbjct: 80 GSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGN 115 >AM294624-1|CAL26622.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLH-GFNAVVSKSGPN 38 G YS +EP G +R+V Y + GF AVV + N Sbjct: 80 GSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGN 115 >AM294623-1|CAL26621.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLH-GFNAVVSKSGPN 38 G YS +EP G +R+V Y + GF AVV + N Sbjct: 80 GSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGN 115 >AM294622-1|CAL26620.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLH-GFNAVVSKSGPN 38 G YS +EP G +R+V Y + GF AVV + N Sbjct: 80 GSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGN 115 >AM294621-1|CAL26619.1| 143|Drosophila melanogaster CG13934 protein. Length = 143 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLH-GFNAVVSKSGPN 38 G YS +EP G +R+V Y + GF AVV + N Sbjct: 80 GSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGN 115 >AE014296-369|AAF47578.1| 143|Drosophila melanogaster CG13934-PA protein. Length = 143 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLH-GFNAVVSKSGPN 38 G YS +EP G +R+V Y + GF AVV + N Sbjct: 80 GSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGN 115 >AY070569-1|AAL48040.1| 241|Drosophila melanogaster RE11283p protein. Length = 241 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNA 30 G YS ++P G RT+ YTA +GF A Sbjct: 65 GSYSYLDPTGQRRTISYTAGK-NGFQA 90 >AE014297-4671|AAF57092.1| 241|Drosophila melanogaster CG12045-PA protein. Length = 241 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNA 30 G YS ++P G RT+ YTA +GF A Sbjct: 65 GSYSYLDPTGQRRTISYTAGK-NGFQA 90 >BT024398-1|ABC86460.1| 150|Drosophila melanogaster IP05065p protein. Length = 150 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 1 MLLGQYSLVEPDGSVRTVDYTADSLHGFNA 30 ++ G YS PDG V T+ Y AD +G+ A Sbjct: 100 VMQGSYSYTGPDGVVYTITYIADE-NGYRA 128 >AY060775-1|AAL28323.1| 197|Drosophila melanogaster GH23965p protein. Length = 197 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNA 30 G YS DG TV+YTAD +GF+A Sbjct: 116 GSYSYTGDDGKQYTVNYTADK-NGFHA 141 >AE014298-1778|AAF48172.1| 197|Drosophila melanogaster CG2555-PA protein. Length = 197 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNA 30 G YS DG TV+YTAD +GF+A Sbjct: 116 GSYSYTGDDGKQYTVNYTADK-NGFHA 141 >AE013599-1477|AAF58517.1| 126|Drosophila melanogaster CG8510-PA protein. Length = 126 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAV 31 G+YS V DG V YTAD +G+ AV Sbjct: 67 GKYSFVADDGKTYVVSYTADE-NGYLAV 93 >AE013599-1472|AAF58520.1| 166|Drosophila melanogaster CG8836-PA protein. Length = 166 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 4 GQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPN 38 G YS + P+G V Y AD+ +GF V++ G N Sbjct: 115 GAYSFITPEGLRVGVKYLADA-NGFRPVITYDGVN 148 >AE013599-1237|AAF58694.1| 135|Drosophila melanogaster CG9079-PA protein. Length = 135 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 1 MLLGQYSLVEPDGSVRTVDYTADSLHGFNA 30 ++ G YS PDG V T+ Y AD +G+ A Sbjct: 85 VMQGSYSYTGPDGVVYTITYIADE-NGYRA 113 >AE014296-2716|AAF49477.1| 217|Drosophila melanogaster CG12255-PA protein. Length = 217 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/38 (36%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Query: 1 MLLGQYSLVEPDGSVRTVDYTADSLHGFNAVVSKSGPN 38 ++ G +S ++ +G +TVDY AD+ GF+ V+ + PN Sbjct: 65 VIRGTFSHIDANGETQTVDYVADA-EGFH--VTSNLPN 99 >AE014134-2321|AAF53275.1| 1413|Drosophila melanogaster CG6108-PA protein. Length = 1413 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 145 PGPLTYPKFGPTPFPEYENFDFDGQIFPQYNQFY 178 P P YP + P P P Y + QI P Y QF+ Sbjct: 39 PYPYYYPYY-PPPLPPYGQQPGEAQIPPGYPQFH 71 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.317 0.139 0.434 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,690,785 Number of Sequences: 52641 Number of extensions: 165658 Number of successful extensions: 706 Number of sequences better than 10.0: 116 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 24 Number of HSP's that attempted gapping in prelim test: 594 Number of HSP's gapped (non-prelim): 136 length of query: 178 length of database: 24,830,863 effective HSP length: 80 effective length of query: 98 effective length of database: 20,619,583 effective search space: 2020719134 effective search space used: 2020719134 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -