BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000248-TA|BGIBMGA000248-PA|IPR000618|Insect cuticle protein (137 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 86 5e-19 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 84 1e-18 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 84 1e-18 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 84 1e-18 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 84 1e-18 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 84 2e-18 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 84 2e-18 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 84 2e-18 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 84 2e-18 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 84 2e-18 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 84 2e-18 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 84 2e-18 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 84 2e-18 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 76 4e-16 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 3.6 AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-tran... 23 3.6 AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CY... 23 4.8 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 22 6.4 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 22 6.4 AY341195-1|AAR13759.1| 294|Anopheles gambiae laminin protein. 22 8.4 AY341194-1|AAR13758.1| 294|Anopheles gambiae laminin protein. 22 8.4 AY341193-1|AAR13757.1| 294|Anopheles gambiae laminin protein. 22 8.4 AY341192-1|AAR13756.1| 294|Anopheles gambiae laminin protein. 22 8.4 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 22 8.4 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 85.8 bits (203), Expect = 5e-19 Identities = 46/114 (40%), Positives = 69/114 (60%), Gaps = 3/114 (2%) Query: 11 TVACAHSRVLTYFRPT-KHV-DLQPSGTIL-HAEPHLGFEHHHISEDEPVDYYAYPKYEF 67 ++A +HS + + RP +HV + + I H+ P + + + V+++A YEF Sbjct: 27 SIATSHSTIQHHARPAIQHVGSIHAAPAIYQHSAPAIVKTIAQPTIIKSVEHHAPANYEF 86 Query: 68 KYGVNDFHTGDIKTHYETRDGDVVKGQYTVVEPDGSIRTVDYTADKYNGFNAIV 121 Y V+D HTGDIK +ETR GD V GQY++++ DG R VDY AD + GFNA+V Sbjct: 87 SYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVV 140 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 84.2 bits (199), Expect = 1e-18 Identities = 45/117 (38%), Positives = 68/117 (58%), Gaps = 5/117 (4%) Query: 11 TVACAHSRVLTYFRPTKH----VDLQPSGTILHAEPHLGFEHHHISEDEPVDYYAYPKYE 66 ++A +HS + + P H V P+ H+ P + + + V+++A YE Sbjct: 27 SIATSHSTIQHHAAPAIHHVGSVHAAPA-IYQHSAPAIVKTIAQPTIIKSVEHHAPANYE 85 Query: 67 FKYGVNDFHTGDIKTHYETRDGDVVKGQYTVVEPDGSIRTVDYTADKYNGFNAIVHK 123 F Y V+D HTGDIK+ +ETR GD V GQY++++ DG R VDY AD + GFNA+V + Sbjct: 86 FSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 84.2 bits (199), Expect = 1e-18 Identities = 45/117 (38%), Positives = 68/117 (58%), Gaps = 5/117 (4%) Query: 11 TVACAHSRVLTYFRPTKH----VDLQPSGTILHAEPHLGFEHHHISEDEPVDYYAYPKYE 66 ++A +HS + + P H V P+ H+ P + + + V+++A YE Sbjct: 27 SIATSHSTIQHHAAPAIHHVGSVHAAPA-IYQHSAPAIVKTIAQPTIIKSVEHHAPANYE 85 Query: 67 FKYGVNDFHTGDIKTHYETRDGDVVKGQYTVVEPDGSIRTVDYTADKYNGFNAIVHK 123 F Y V+D HTGDIK+ +ETR GD V GQY++++ DG R VDY AD + GFNA+V + Sbjct: 86 FSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 84.2 bits (199), Expect = 1e-18 Identities = 45/117 (38%), Positives = 68/117 (58%), Gaps = 5/117 (4%) Query: 11 TVACAHSRVLTYFRPTKH----VDLQPSGTILHAEPHLGFEHHHISEDEPVDYYAYPKYE 66 ++A +HS + + P H V P+ H+ P + + + V+++A YE Sbjct: 27 SIATSHSTIQHHAAPAIHHVGSVHAAPA-IYQHSAPAIVKTIAQPTIIKSVEHHAPANYE 85 Query: 67 FKYGVNDFHTGDIKTHYETRDGDVVKGQYTVVEPDGSIRTVDYTADKYNGFNAIVHK 123 F Y V+D HTGDIK+ +ETR GD V GQY++++ DG R VDY AD + GFNA+V + Sbjct: 86 FSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 84.2 bits (199), Expect = 1e-18 Identities = 45/117 (38%), Positives = 68/117 (58%), Gaps = 5/117 (4%) Query: 11 TVACAHSRVLTYFRPTKH----VDLQPSGTILHAEPHLGFEHHHISEDEPVDYYAYPKYE 66 ++A +HS + + P H V P+ H+ P + + + V+++A YE Sbjct: 27 SIASSHSTIQHHAAPAIHHVGSVHAAPA-IYQHSAPAIVKTIAQPTIIKSVEHHAPANYE 85 Query: 67 FKYGVNDFHTGDIKTHYETRDGDVVKGQYTVVEPDGSIRTVDYTADKYNGFNAIVHK 123 F Y V+D HTGDIK+ +ETR GD V GQY++++ DG R VDY AD + GFNA+V + Sbjct: 86 FSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 83.8 bits (198), Expect = 2e-18 Identities = 36/67 (53%), Positives = 49/67 (73%) Query: 57 VDYYAYPKYEFKYGVNDFHTGDIKTHYETRDGDVVKGQYTVVEPDGSIRTVDYTADKYNG 116 V+++A YEF Y V+D HTGDIK+ +ETR GD V GQY++++ DG R VDY AD + G Sbjct: 84 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 Query: 117 FNAIVHK 123 FNA+V + Sbjct: 144 FNAVVRR 150 Score = 22.6 bits (46), Expect = 4.8 Identities = 9/18 (50%), Positives = 10/18 (55%) Query: 120 IVHKTAPISPHEAAHLHH 137 I H API+ H A HH Sbjct: 192 IAHYAAPIAHHAAPIAHH 209 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 83.8 bits (198), Expect = 2e-18 Identities = 36/67 (53%), Positives = 49/67 (73%) Query: 57 VDYYAYPKYEFKYGVNDFHTGDIKTHYETRDGDVVKGQYTVVEPDGSIRTVDYTADKYNG 116 V+++A YEF Y V+D HTGDIK+ +ETR GD V GQY++++ DG R VDY AD + G Sbjct: 76 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 Query: 117 FNAIVHK 123 FNA+V + Sbjct: 136 FNAVVRR 142 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 83.8 bits (198), Expect = 2e-18 Identities = 36/67 (53%), Positives = 49/67 (73%) Query: 57 VDYYAYPKYEFKYGVNDFHTGDIKTHYETRDGDVVKGQYTVVEPDGSIRTVDYTADKYNG 116 V+++A YEF Y V+D HTGDIK+ +ETR GD V GQY++++ DG R VDY AD + G Sbjct: 76 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 135 Query: 117 FNAIVHK 123 FNA+V + Sbjct: 136 FNAVVRR 142 Score = 22.6 bits (46), Expect = 4.8 Identities = 9/18 (50%), Positives = 10/18 (55%) Query: 120 IVHKTAPISPHEAAHLHH 137 I H API+ H A HH Sbjct: 194 IAHYAAPIAHHAAPIAHH 211 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 83.8 bits (198), Expect = 2e-18 Identities = 36/67 (53%), Positives = 49/67 (73%) Query: 57 VDYYAYPKYEFKYGVNDFHTGDIKTHYETRDGDVVKGQYTVVEPDGSIRTVDYTADKYNG 116 V+++A YEF Y V+D HTGDIK+ +ETR GD V GQY++++ DG R VDY AD + G Sbjct: 84 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTG 143 Query: 117 FNAIVHK 123 FNA+V + Sbjct: 144 FNAVVRR 150 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 83.8 bits (198), Expect = 2e-18 Identities = 36/67 (53%), Positives = 49/67 (73%) Query: 57 VDYYAYPKYEFKYGVNDFHTGDIKTHYETRDGDVVKGQYTVVEPDGSIRTVDYTADKYNG 116 V+++A YEF Y V+D HTGDIK+ +ETR GD V GQY++++ DG R VDY AD + G Sbjct: 84 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 Query: 117 FNAIVHK 123 FNA+V + Sbjct: 144 FNAVVRR 150 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 83.8 bits (198), Expect = 2e-18 Identities = 36/67 (53%), Positives = 49/67 (73%) Query: 57 VDYYAYPKYEFKYGVNDFHTGDIKTHYETRDGDVVKGQYTVVEPDGSIRTVDYTADKYNG 116 V+++A YEF Y V+D HTGDIK+ +ETR GD V GQY++++ DG R VDY AD + G Sbjct: 108 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 167 Query: 117 FNAIVHK 123 FNA+V + Sbjct: 168 FNAVVRR 174 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 83.8 bits (198), Expect = 2e-18 Identities = 36/67 (53%), Positives = 49/67 (73%) Query: 57 VDYYAYPKYEFKYGVNDFHTGDIKTHYETRDGDVVKGQYTVVEPDGSIRTVDYTADKYNG 116 V+++A YEF Y V+D HTGDIK+ +ETR GD V GQY++++ DG R VDY AD + G Sbjct: 84 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 Query: 117 FNAIVHK 123 FNA+V + Sbjct: 144 FNAVVRR 150 Score = 22.6 bits (46), Expect = 4.8 Identities = 9/18 (50%), Positives = 10/18 (55%) Query: 120 IVHKTAPISPHEAAHLHH 137 I H API+ H A HH Sbjct: 192 IAHYAAPIAHHAAPIAHH 209 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 83.8 bits (198), Expect = 2e-18 Identities = 36/67 (53%), Positives = 49/67 (73%) Query: 57 VDYYAYPKYEFKYGVNDFHTGDIKTHYETRDGDVVKGQYTVVEPDGSIRTVDYTADKYNG 116 V+++A YEF Y V+D HTGDIK+ +ETR GD V GQY++++ DG R VDY AD + G Sbjct: 84 VEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTG 143 Query: 117 FNAIVHK 123 FNA+V + Sbjct: 144 FNAVVRR 150 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 76.2 bits (179), Expect = 4e-16 Identities = 32/48 (66%), Positives = 41/48 (85%) Query: 76 TGDIKTHYETRDGDVVKGQYTVVEPDGSIRTVDYTADKYNGFNAIVHK 123 TGD K+ E+RDGDVV+G Y+VV+PDG+ RTVDYTAD +NGFNA+V + Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNGFNAVVRR 81 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 3.6 Identities = 9/20 (45%), Positives = 10/20 (50%) Query: 38 LHAEPHLGFEHHHISEDEPV 57 LH H G HHH E P+ Sbjct: 1314 LHHHLHHGHHHHHGGEGVPM 1333 >AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-transferase D12 protein. Length = 211 Score = 23.0 bits (47), Expect = 3.6 Identities = 12/39 (30%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Query: 28 HVDLQPSGTILHAEPHLGFEHHHI--SEDEPVDYYAYPK 64 H+ P ++ HLG E +HI S +P D+ K Sbjct: 6 HIRSPPCQPVVFLARHLGLEFNHIVTSIYDPADFEVLKK 44 >AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CYP4C27 protein. Length = 150 Score = 22.6 bits (46), Expect = 4.8 Identities = 10/36 (27%), Positives = 19/36 (52%) Query: 20 LTYFRPTKHVDLQPSGTILHAEPHLGFEHHHISEDE 55 +++F T D+Q G + A+ +G +H+ DE Sbjct: 75 VSFFGRTLSEDVQLGGHQVPAQTIVGIHAYHVHRDE 110 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 22.2 bits (45), Expect = 6.4 Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Query: 86 RDGDVVKGQYTVVEPDGSIRTVDYTADKYNGFNAI 120 R+G+ G +VEP+G ++ A+ +G AI Sbjct: 463 REGETCTGLQVIVEPNG-FASISIRANAEDGVIAI 496 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 22.2 bits (45), Expect = 6.4 Identities = 7/12 (58%), Positives = 7/12 (58%) Query: 39 HAEPHLGFEHHH 50 HA PH HHH Sbjct: 499 HAHPHHHHHHHH 510 >AY341195-1|AAR13759.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/34 (26%), Positives = 18/34 (52%) Query: 92 KGQYTVVEPDGSIRTVDYTADKYNGFNAIVHKTA 125 + + V E DG+++ +YT GF V +++ Sbjct: 223 QAEKAVAEGDGTLQKANYTYQTLAGFKNQVEESS 256 >AY341194-1|AAR13758.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/34 (26%), Positives = 18/34 (52%) Query: 92 KGQYTVVEPDGSIRTVDYTADKYNGFNAIVHKTA 125 + + V E DG+++ +YT GF V +++ Sbjct: 223 QAEKAVAEGDGTLQKANYTYQTLAGFKNQVEESS 256 >AY341193-1|AAR13757.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/34 (26%), Positives = 18/34 (52%) Query: 92 KGQYTVVEPDGSIRTVDYTADKYNGFNAIVHKTA 125 + + V E DG+++ +YT GF V +++ Sbjct: 223 QAEKAVAEGDGTLQKANYTYQTLAGFKNQVEESS 256 >AY341192-1|AAR13756.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/34 (26%), Positives = 18/34 (52%) Query: 92 KGQYTVVEPDGSIRTVDYTADKYNGFNAIVHKTA 125 + + V E DG+++ +YT GF V +++ Sbjct: 223 QAEKAVAEGDGTLQKANYTYQTLAGFKNQVEESS 256 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/34 (26%), Positives = 18/34 (52%) Query: 92 KGQYTVVEPDGSIRTVDYTADKYNGFNAIVHKTA 125 + + V E DG+++ +YT GF V +++ Sbjct: 1362 QAEKAVAEGDGTLQKANYTYQTLAGFKNQVEESS 1395 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.137 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,462 Number of Sequences: 2123 Number of extensions: 7491 Number of successful extensions: 50 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 46 length of query: 137 length of database: 516,269 effective HSP length: 58 effective length of query: 79 effective length of database: 393,135 effective search space: 31057665 effective search space used: 31057665 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -