BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000247-TA|BGIBMGA000247-PA|IPR000618|Insect cuticle protein (168 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 34 0.002 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 34 0.002 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 34 0.002 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 34 0.002 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 34 0.002 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 34 0.002 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 34 0.002 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 34 0.002 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 34 0.002 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 34 0.002 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 34 0.002 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 34 0.002 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 34 0.003 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 27 0.30 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 25 1.6 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 24 2.8 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 24 2.8 AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. 23 6.5 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 23 6.5 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 22 8.6 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 22 8.6 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 34.3 bits (75), Expect = 0.002 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 45 PGTYSFGYDILDPNTGNSQYRNEERYPNGTVTGSYGYVDAAGKPQRFRYVAD 96 P Y F Y + D +TG+ + ++E R+ V G Y +D+ G + Y AD Sbjct: 89 PANYEFSYSVHDEHTGDIKSQHETRH-GDEVHGQYSLLDSDGHQRIVDYHAD 139 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 34.3 bits (75), Expect = 0.002 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 45 PGTYSFGYDILDPNTGNSQYRNEERYPNGTVTGSYGYVDAAGKPQRFRYVAD 96 P Y F Y + D +TG+ + ++E R+ V G Y +D+ G + Y AD Sbjct: 81 PANYEFSYSVHDEHTGDIKSQHETRH-GDEVHGQYSLLDSDGHQRIVDYHAD 131 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 34.3 bits (75), Expect = 0.002 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 45 PGTYSFGYDILDPNTGNSQYRNEERYPNGTVTGSYGYVDAAGKPQRFRYVAD 96 P Y F Y + D +TG+ + ++E R+ V G Y +D+ G + Y AD Sbjct: 81 PANYEFSYSVHDEHTGDIKSQHETRH-GDEVHGQYSLLDSDGHQRIVDYHAD 131 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 34.3 bits (75), Expect = 0.002 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 45 PGTYSFGYDILDPNTGNSQYRNEERYPNGTVTGSYGYVDAAGKPQRFRYVAD 96 P Y F Y + D +TG+ + ++E R+ V G Y +D+ G + Y AD Sbjct: 81 PANYEFSYSVHDEHTGDIKSQHETRH-GDEVHGQYSLLDSDGHQRIVDYHAD 131 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 34.3 bits (75), Expect = 0.002 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 45 PGTYSFGYDILDPNTGNSQYRNEERYPNGTVTGSYGYVDAAGKPQRFRYVAD 96 P Y F Y + D +TG+ + ++E R+ V G Y +D+ G + Y AD Sbjct: 81 PANYEFSYSVHDEHTGDIKSQHETRH-GDEVHGQYSLLDSDGHQRIVDYHAD 131 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 34.3 bits (75), Expect = 0.002 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 45 PGTYSFGYDILDPNTGNSQYRNEERYPNGTVTGSYGYVDAAGKPQRFRYVAD 96 P Y F Y + D +TG+ + ++E R+ V G Y +D+ G + Y AD Sbjct: 89 PANYEFSYSVHDEHTGDIKSQHETRH-GDEVHGQYSLLDSDGHQRIVDYHAD 139 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 34.3 bits (75), Expect = 0.002 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 45 PGTYSFGYDILDPNTGNSQYRNEERYPNGTVTGSYGYVDAAGKPQRFRYVAD 96 P Y F Y + D +TG+ + ++E R+ V G Y +D+ G + Y AD Sbjct: 113 PANYEFSYSVHDEHTGDIKSQHETRH-GDEVHGQYSLLDSDGHQRIVDYHAD 163 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 34.3 bits (75), Expect = 0.002 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 45 PGTYSFGYDILDPNTGNSQYRNEERYPNGTVTGSYGYVDAAGKPQRFRYVAD 96 P Y F Y + D +TG+ + ++E R+ V G Y +D+ G + Y AD Sbjct: 81 PANYEFSYSVHDEHTGDIKSQHETRH-GDEVHGQYSLLDSDGHQRIVDYHAD 131 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 34.3 bits (75), Expect = 0.002 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 45 PGTYSFGYDILDPNTGNSQYRNEERYPNGTVTGSYGYVDAAGKPQRFRYVAD 96 P Y F Y + D +TG+ + ++E R+ V G Y +D+ G + Y AD Sbjct: 89 PANYEFSYSVHDEHTGDIKSQHETRH-GDEVHGQYSLLDSDGHQRIVDYHAD 139 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 34.3 bits (75), Expect = 0.002 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 45 PGTYSFGYDILDPNTGNSQYRNEERYPNGTVTGSYGYVDAAGKPQRFRYVAD 96 P Y F Y + D +TG+ + ++E R+ V G Y +D+ G + Y AD Sbjct: 81 PANYEFSYSVHDEHTGDIKSQHETRH-GDEVHGQYSLLDSDGHQRIVDYHAD 131 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 34.3 bits (75), Expect = 0.002 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 45 PGTYSFGYDILDPNTGNSQYRNEERYPNGTVTGSYGYVDAAGKPQRFRYVAD 96 P Y F Y + D +TG+ + ++E R+ V G Y +D+ G + Y AD Sbjct: 89 PANYEFSYSVHDEHTGDIKSQHETRH-GDEVHGQYSLLDSDGHQRIVDYHAD 139 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 34.3 bits (75), Expect = 0.002 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 45 PGTYSFGYDILDPNTGNSQYRNEERYPNGTVTGSYGYVDAAGKPQRFRYVAD 96 P Y F Y + D +TG+ + ++E R+ V G Y +D+ G + Y AD Sbjct: 81 PANYEFSYSVHDEHTGDIKNQHETRH-GDEVHGQYSLLDSDGHQRIVDYHAD 131 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 33.9 bits (74), Expect = 0.003 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 45 PGTYSFGYDILDPNTGNSQYRNEERYPNGTVTGSYGYVDAAGKPQRFRYVAD 96 P Y F Y + D +TG+ + ++E R+ V G Y +D+ G + Y AD Sbjct: 89 PANYEFSYSVHDEHTGDIKSQHETRH-GDEVHGQYSLLDSDGHHRIVDYHAD 139 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 27.1 bits (57), Expect = 0.30 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 59 TGNSQYRNEERYPNGTVTGSYGYVDAAGKPQRFRYVAD 96 TG+S+ + E R V GSY VD G + Y AD Sbjct: 34 TGDSKSQQESR-DGDVVQGSYSVVDPDGTKRTVDYTAD 70 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 24.6 bits (51), Expect = 1.6 Identities = 12/50 (24%), Positives = 19/50 (38%) Query: 113 QAQTPPVRMPGDSATESSITWSRPKKKNKRKPVAEMMKSEENININSLRQ 162 Q + P R D T W R + R + +M K + + N+ Q Sbjct: 280 QLKNQPARSADDLWTRCKFMWERIDRSESRNLIGDMAKRCQEVIANNGHQ 329 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.8 bits (49), Expect = 2.8 Identities = 12/30 (40%), Positives = 15/30 (50%) Query: 115 QTPPVRMPGDSATESSITWSRPKKKNKRKP 144 ++PP R S +S SRP K KR P Sbjct: 272 RSPPARRRSRSTRPTSWPRSRPTSKPKRLP 301 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 23.8 bits (49), Expect = 2.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Query: 123 GDSATESSITWSRPKKKNKRKP 144 G E+ +WS +KN+RKP Sbjct: 205 GPEMNETKGSWSTVVRKNRRKP 226 >AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. Length = 259 Score = 22.6 bits (46), Expect = 6.5 Identities = 12/34 (35%), Positives = 19/34 (55%) Query: 94 VADEKGYRIFQEISHLPLVQAQTPPVRMPGDSAT 127 VA E + Q+IS+ P Q+ T P+R + +T Sbjct: 117 VAAELKNMVLQDISNQPKQQSTTRPLRKCRNKST 150 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 22.6 bits (46), Expect = 6.5 Identities = 12/34 (35%), Positives = 19/34 (55%) Query: 94 VADEKGYRIFQEISHLPLVQAQTPPVRMPGDSAT 127 VA E + Q+IS+ P Q+ T P+R + +T Sbjct: 118 VAAELKNMVLQDISNQPKQQSTTRPLRKCRNKST 151 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 22.2 bits (45), Expect = 8.6 Identities = 9/36 (25%), Positives = 19/36 (52%) Query: 117 PPVRMPGDSATESSITWSRPKKKNKRKPVAEMMKSE 152 P +R+ +A S RP +KN ++ + E ++ + Sbjct: 448 PSIRIEPPAAIPSQEVRKRPPEKNPKEEIDEELEEQ 483 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 22.2 bits (45), Expect = 8.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Query: 122 PGDSATESSITWSRPKKKNKRKPVAEMMKSEENINI 157 P S +S + KK++ KP A +++ ENI++ Sbjct: 148 PKSSGGQSKQPKKKKKKRSLPKPEAVVIEKCENIDL 183 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.314 0.131 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,104 Number of Sequences: 2123 Number of extensions: 8292 Number of successful extensions: 26 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 21 length of query: 168 length of database: 516,269 effective HSP length: 60 effective length of query: 108 effective length of database: 388,889 effective search space: 42000012 effective search space used: 42000012 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -