BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000247-TA|BGIBMGA000247-PA|IPR000618|Insect cuticle protein (168 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 28 0.056 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 1.2 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 21 8.4 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 27.9 bits (59), Expect = 0.056 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Query: 77 GSYGYVDAAGKPQRFRYVADEKGYRIFQEISHLPLVQAQTPPVR 120 GS Y G+ YVADE G+++ + SH+P P ++ Sbjct: 73 GSDSYTAPDGQQVSITYVADENGFQV--QGSHIPTAPPIPPEIQ 114 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/57 (21%), Positives = 31/57 (54%) Query: 109 LPLVQAQTPPVRMPGDSATESSITWSRPKKKNKRKPVAEMMKSEENININSLRQPSF 165 L + A V +PG++ ++ T S ++ R+P++E + S + + ++L + ++ Sbjct: 1294 LTVNHAYRDAVTVPGNNLIATNTTVSSGSSEDHRRPLSEHIYSSIDSDYSTLERTAW 1350 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 20.6 bits (41), Expect = 8.4 Identities = 9/16 (56%), Positives = 10/16 (62%) Query: 41 VNGNPGTYSFGYDILD 56 VN NP T S YD+ D Sbjct: 417 VNYNPETVSTDYDMSD 432 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.314 0.131 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,205 Number of Sequences: 429 Number of extensions: 2747 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 168 length of database: 140,377 effective HSP length: 53 effective length of query: 115 effective length of database: 117,640 effective search space: 13528600 effective search space used: 13528600 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.5 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -