GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000246-TA|BGIBMGA000246-PA|IPR000618|Insect cuticle
protein
         (157 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle pr...    25   0.36 

>EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle
           protein protein.
          Length = 138

 Score = 25.0 bits (52), Expect = 0.36
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 72  GVKDLHTGDIKSQQEQRDGDVVKGSYSLVEPDGTTRTVHYTADDHTGF 119
           G+    +G  K Q +     V +GS S   PDG   ++ Y AD++ GF
Sbjct: 51  GISHQESGQPK-QVDNETPVVSQGSDSYTAPDGQQVSITYVADEN-GF 96


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.317    0.136    0.409 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,982
Number of Sequences: 429
Number of extensions: 773
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 157
length of database: 140,377
effective HSP length: 53
effective length of query: 104
effective length of database: 117,640
effective search space: 12234560
effective search space used: 12234560
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 41 (20.6 bits)