BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000245-TA|BGIBMGA000245-PA|IPR000618|Insect cuticle protein (170 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 31 0.004 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 0.58 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 20 9.5 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 20 9.5 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 31.5 bits (68), Expect = 0.004 Identities = 20/45 (44%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Query: 91 YGVEDPHTGNLQNHKEQRDGDVVRGEYSLVE-PDGSVRLVRYTAD 134 Y VE + + + DG +V GEY +V DGS+R VRYTAD Sbjct: 195 YVVEGRNYRKYRVEERTSDGFIV-GEYGVVSHDDGSLRGVRYTAD 238 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.2 bits (50), Expect = 0.58 Identities = 9/29 (31%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Query: 89 YAYGVEDPHTGNLQNHKEQRDGDVVRGEY 117 YA+ DPH N+ ++ + + D+++G Y Sbjct: 209 YAFATIDPHNFNMISNDD--ESDIIQGGY 235 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 20.2 bits (40), Expect = 9.5 Identities = 8/26 (30%), Positives = 11/26 (42%) Query: 85 PDYTYAYGVEDPHTGNLQNHKEQRDG 110 P Y Y P++ N NH+ G Sbjct: 355 PQQQYYYNKNHPNSENYINHQNYVQG 380 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 20.2 bits (40), Expect = 9.5 Identities = 8/26 (30%), Positives = 11/26 (42%) Query: 85 PDYTYAYGVEDPHTGNLQNHKEQRDG 110 P Y Y P++ N NH+ G Sbjct: 303 PQQQYYYNKNHPNSENYINHQNYVQG 328 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.315 0.135 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 45,820 Number of Sequences: 317 Number of extensions: 1942 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 170 length of database: 114,650 effective HSP length: 53 effective length of query: 117 effective length of database: 97,849 effective search space: 11448333 effective search space used: 11448333 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.1 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -