BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000245-TA|BGIBMGA000245-PA|IPR000618|Insect cuticle protein (170 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1322.10 |||conserved fungal protein|Schizosaccharomyces pomb... 28 0.64 SPAPB2C8.01 |||glycoprotein |Schizosaccharomyces pombe|chr 1|||M... 27 1.1 SPBC1105.06 |pmc4|med4|RNA polymerase II holoenzyme component Pm... 25 4.5 >SPCC1322.10 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 262 Score = 28.3 bits (60), Expect = 0.64 Identities = 13/38 (34%), Positives = 20/38 (52%) Query: 14 ATPAFTGKTGGYSYNRFSGPVSGQIVEVQVPAAEGIPA 51 A+ + G + SY +SG VS + ++ V A GI A Sbjct: 220 ASSSAAGNSSSSSYTSYSGAVSNGVAQLSVAACMGIAA 257 >SPAPB2C8.01 |||glycoprotein |Schizosaccharomyces pombe|chr 1|||Manual Length = 1220 Score = 27.5 bits (58), Expect = 1.1 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 4/60 (6%) Query: 9 VAILLATPA--FTGKTGG-YSYNRFSGPVSGQIVEVQVPAAEGIPAQQHADYGYDHNSGK 65 V ++L P +TG +Y+ S PVS +V + G+ Q+A Y YD ++ K Sbjct: 966 VEVILPAPTTIYTGTVATTITYSSSSTPVS-TVVVIPTAVCSGVRGLQYAVYNYDISASK 1024 >SPBC1105.06 |pmc4|med4|RNA polymerase II holoenzyme component Pmc4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 239 Score = 25.4 bits (53), Expect = 4.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 146 KAGGQAQAPVHYGHPKQDE 164 + G A+APVHY P +D+ Sbjct: 127 ETGQDAKAPVHYPWPSEDQ 145 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.315 0.135 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 886,725 Number of Sequences: 5004 Number of extensions: 36942 Number of successful extensions: 48 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 46 Number of HSP's gapped (non-prelim): 3 length of query: 170 length of database: 2,362,478 effective HSP length: 68 effective length of query: 102 effective length of database: 2,022,206 effective search space: 206265012 effective search space used: 206265012 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -