BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000245-TA|BGIBMGA000245-PA|IPR000618|Insect cuticle protein (170 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0889 - 22316945-22317062,22317149-22318794 29 1.5 08_01_0684 + 6009474-6009582,6009715-6009904,6011412-6011483,601... 29 2.6 02_02_0074 + 6567362-6567550,6567685-6567753,6567869-6567970,656... 28 3.4 06_01_0601 + 4337575-4340149,4340566-4340978 27 6.0 01_03_0050 + 11959421-11959736,11959892-11959960,11960641-119609... 27 8.0 >07_03_0889 - 22316945-22317062,22317149-22318794 Length = 587 Score = 29.5 bits (63), Expect = 1.5 Identities = 27/81 (33%), Positives = 36/81 (44%), Gaps = 6/81 (7%) Query: 13 LATPAFTGKTGGYSYNRFSGPVSGQIVEVQVPAAEGIPAQQHADYGYDHNSGKIHPDTAK 72 LA A G GG + +G V G +VE A+E +P Q YG GK+ + Sbjct: 57 LADIATGGGEGGEGHGALAG-VLGAVVETAREASELVPRSQGRHYG----GGKLRLRSDL 111 Query: 73 YAHLKTVD-YVAKPDYTYAYG 92 T+D VA+ D YA G Sbjct: 112 DVVAGTLDALVARVDEVYASG 132 >08_01_0684 + 6009474-6009582,6009715-6009904,6011412-6011483, 6011644-6011715,6011806-6011877,6012163-6012234, 6012283-6012354,6012479-6012550,6012634-6012705, 6013112-6013183,6013275-6013349,6013453-6013524, 6013619-6013684,6013752-6013777,6014179-6014558, 6014642-6014840,6014910-6015068,6015569-6015613, 6015742-6015973,6016053-6016203,6016306-6016665 Length = 879 Score = 28.7 bits (61), Expect = 2.6 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 59 YDHNSGKIHPDTAKYAHLKTVDYVAKPDYTYAYGVEDPHTGNLQNHKEQRDGDVVRGEYS 118 Y ++G P + + LK + + D + + D G+L N ++ R GD+V G S Sbjct: 221 YTDSAGLSGPFPSTLSRLKNLKLLRASDNNFTGTIPD-FIGSLSNLEDLRIGDIVNGSSS 279 Query: 119 L 119 L Sbjct: 280 L 280 >02_02_0074 + 6567362-6567550,6567685-6567753,6567869-6567970, 6568386-6568627,6569057-6569195,6569298-6569333, 6569838-6569972,6570315-6570547,6571204-6571298, 6571331-6571374,6571808-6571888 Length = 454 Score = 28.3 bits (60), Expect = 3.4 Identities = 12/38 (31%), Positives = 18/38 (47%) Query: 32 GPVSGQIVEVQVPAAEGIPAQQHADYGYDHNSGKIHPD 69 G +S +E + +GIP + Y Y H S + PD Sbjct: 168 GCISATPIEKPIDIVDGIPLEMPLAYFYGHPSPSVSPD 205 >06_01_0601 + 4337575-4340149,4340566-4340978 Length = 995 Score = 27.5 bits (58), Expect = 6.0 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Query: 12 LLATPAFTGKTGGYSYNRFSGPVSGQ 37 L A+PA + +SYN+FSG VSG+ Sbjct: 532 LQASPAL--RYANFSYNKFSGEVSGE 555 >01_03_0050 + 11959421-11959736,11959892-11959960,11960641-11960979, 11961090-11961152,11962472-11962962,11963773-11964441 Length = 648 Score = 27.1 bits (57), Expect = 8.0 Identities = 13/48 (27%), Positives = 23/48 (47%) Query: 100 NLQNHKEQRDGDVVRGEYSLVEPDGSVRLVRYTADPKNGFQAVVHKKA 147 N+ + +E + V S PD + Y+++ K+G + HKKA Sbjct: 362 NILSKEEDKPAHAVISTLSKRAPDCQTEVTMYSSEEKSGERCQSHKKA 409 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.315 0.135 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,954,246 Number of Sequences: 37544 Number of extensions: 263303 Number of successful extensions: 386 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 384 Number of HSP's gapped (non-prelim): 5 length of query: 170 length of database: 14,793,348 effective HSP length: 77 effective length of query: 93 effective length of database: 11,902,460 effective search space: 1106928780 effective search space used: 1106928780 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -