BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000245-TA|BGIBMGA000245-PA|IPR000618|Insect cuticle protein (170 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 81 2e-17 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 80 4e-17 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 80 4e-17 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 80 4e-17 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 80 4e-17 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 79 5e-17 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 79 7e-17 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 79 7e-17 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 79 7e-17 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 79 7e-17 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 79 7e-17 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 79 1e-16 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 79 1e-16 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 68 1e-13 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 26 0.71 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 25 1.6 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 6.6 AF525673-3|AAM82612.1| 58|Anopheles gambiae cecropin CecC prot... 22 8.8 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 81.0 bits (191), Expect = 2e-17 Identities = 42/114 (36%), Positives = 64/114 (56%), Gaps = 1/114 (0%) Query: 44 PAAEGIPAQQHADYGYDHNSGKIHPDTAKYAHLKTVDYVAKPDYTYAYGVEDPHTGNLQN 103 PA + + + A Y H++ I A+ +K+V++ A +Y ++Y V D HTG+++N Sbjct: 41 PAIQHVGSIHAAPAIYQHSAPAIVKTIAQPTIIKSVEHHAPANYEFSYSVHDEHTGDIKN 100 Query: 104 HKEQRDGDVVRGEYSLVEPDGSVRLVRYTADPKNGFQAVVHKKAGG-QAQAPVH 156 E R GD V G+YSL++ DG R+V Y AD GF AVV + + PVH Sbjct: 101 QHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRPEPSAVKIAQPVH 154 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 79.8 bits (188), Expect = 4e-17 Identities = 41/114 (35%), Positives = 64/114 (56%), Gaps = 1/114 (0%) Query: 44 PAAEGIPAQQHADYGYDHNSGKIHPDTAKYAHLKTVDYVAKPDYTYAYGVEDPHTGNLQN 103 PA + + A Y H++ I A+ +K+V++ A +Y ++Y V D HTG++++ Sbjct: 41 PAIHHVGSVHAAPAIYQHSAPAIVKTIAQPTIIKSVEHHAPANYEFSYSVHDEHTGDIKS 100 Query: 104 HKEQRDGDVVRGEYSLVEPDGSVRLVRYTADPKNGFQAVVHKKAGG-QAQAPVH 156 E R GD V G+YSL++ DG R+V Y AD GF AVV ++ + PVH Sbjct: 101 QHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRREPSAVKIAQPVH 154 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 79.8 bits (188), Expect = 4e-17 Identities = 41/114 (35%), Positives = 64/114 (56%), Gaps = 1/114 (0%) Query: 44 PAAEGIPAQQHADYGYDHNSGKIHPDTAKYAHLKTVDYVAKPDYTYAYGVEDPHTGNLQN 103 PA + + A Y H++ I A+ +K+V++ A +Y ++Y V D HTG++++ Sbjct: 41 PAIHHVGSVHAAPAIYQHSAPAIVKTIAQPTIIKSVEHHAPANYEFSYSVHDEHTGDIKS 100 Query: 104 HKEQRDGDVVRGEYSLVEPDGSVRLVRYTADPKNGFQAVVHKKAGG-QAQAPVH 156 E R GD V G+YSL++ DG R+V Y AD GF AVV ++ + PVH Sbjct: 101 QHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRREPSAVKIAQPVH 154 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 79.8 bits (188), Expect = 4e-17 Identities = 41/114 (35%), Positives = 64/114 (56%), Gaps = 1/114 (0%) Query: 44 PAAEGIPAQQHADYGYDHNSGKIHPDTAKYAHLKTVDYVAKPDYTYAYGVEDPHTGNLQN 103 PA + + A Y H++ I A+ +K+V++ A +Y ++Y V D HTG++++ Sbjct: 41 PAIHHVGSVHAAPAIYQHSAPAIVKTIAQPTIIKSVEHHAPANYEFSYSVHDEHTGDIKS 100 Query: 104 HKEQRDGDVVRGEYSLVEPDGSVRLVRYTADPKNGFQAVVHKKAGG-QAQAPVH 156 E R GD V G+YSL++ DG R+V Y AD GF AVV ++ + PVH Sbjct: 101 QHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRREPSAVKIAQPVH 154 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 79.8 bits (188), Expect = 4e-17 Identities = 41/114 (35%), Positives = 64/114 (56%), Gaps = 1/114 (0%) Query: 44 PAAEGIPAQQHADYGYDHNSGKIHPDTAKYAHLKTVDYVAKPDYTYAYGVEDPHTGNLQN 103 PA + + A Y H++ I A+ +K+V++ A +Y ++Y V D HTG++++ Sbjct: 41 PAIHHVGSVHAAPAIYQHSAPAIVKTIAQPTIIKSVEHHAPANYEFSYSVHDEHTGDIKS 100 Query: 104 HKEQRDGDVVRGEYSLVEPDGSVRLVRYTADPKNGFQAVVHKKAGG-QAQAPVH 156 E R GD V G+YSL++ DG R+V Y AD GF AVV ++ + PVH Sbjct: 101 QHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRREPSAVKIAQPVH 154 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 79.4 bits (187), Expect = 5e-17 Identities = 41/114 (35%), Positives = 64/114 (56%), Gaps = 1/114 (0%) Query: 44 PAAEGIPAQQHADYGYDHNSGKIHPDTAKYAHLKTVDYVAKPDYTYAYGVEDPHTGNLQN 103 PA + + A Y H++ I A+ +K+V++ A +Y ++Y V D HTG++++ Sbjct: 41 PAIHHVGSIHAAPAIYQHSAPTIVKTIAQPTIIKSVEHHAPANYEFSYSVHDEHTGDIKS 100 Query: 104 HKEQRDGDVVRGEYSLVEPDGSVRLVRYTADPKNGFQAVVHKKAGG-QAQAPVH 156 E R GD V G+YSL++ DG R+V Y AD GF AVV ++ + PVH Sbjct: 101 QHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRREPSAVKIAQPVH 154 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 79.0 bits (186), Expect = 7e-17 Identities = 40/106 (37%), Positives = 61/106 (57%), Gaps = 1/106 (0%) Query: 52 QQHADYGYDHNSGKIHPDTAKYAHLKTVDYVAKPDYTYAYGVEDPHTGNLQNHKEQRDGD 111 Q A Y H++ I A+ +K+V++ A +Y ++Y V D HTG++++ E R GD Sbjct: 57 QHSAPAIYQHSAPAIVKTIAQPTIIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGD 116 Query: 112 VVRGEYSLVEPDGSVRLVRYTADPKNGFQAVVHKKAGG-QAQAPVH 156 V G+YSL++ DG R+V Y AD GF AVV ++ + PVH Sbjct: 117 EVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRREPSAVKIAQPVH 162 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 79.0 bits (186), Expect = 7e-17 Identities = 40/106 (37%), Positives = 61/106 (57%), Gaps = 1/106 (0%) Query: 52 QQHADYGYDHNSGKIHPDTAKYAHLKTVDYVAKPDYTYAYGVEDPHTGNLQNHKEQRDGD 111 Q A Y H++ I A+ +K+V++ A +Y ++Y V D HTG++++ E R GD Sbjct: 57 QHSAPAIYQHSAPAIVKTIAQPTIIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGD 116 Query: 112 VVRGEYSLVEPDGSVRLVRYTADPKNGFQAVVHKKAGG-QAQAPVH 156 V G+YSL++ DG R+V Y AD GF AVV ++ + PVH Sbjct: 117 EVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRREPSAVKIAQPVH 162 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 79.0 bits (186), Expect = 7e-17 Identities = 40/106 (37%), Positives = 61/106 (57%), Gaps = 1/106 (0%) Query: 52 QQHADYGYDHNSGKIHPDTAKYAHLKTVDYVAKPDYTYAYGVEDPHTGNLQNHKEQRDGD 111 Q A Y H++ I A+ +K+V++ A +Y ++Y V D HTG++++ E R GD Sbjct: 81 QHSAPAIYQHSAPAIVKTIAQPTIIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGD 140 Query: 112 VVRGEYSLVEPDGSVRLVRYTADPKNGFQAVVHKKAGG-QAQAPVH 156 V G+YSL++ DG R+V Y AD GF AVV ++ + PVH Sbjct: 141 EVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRREPSAVKIAQPVH 186 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 79.0 bits (186), Expect = 7e-17 Identities = 41/106 (38%), Positives = 61/106 (57%), Gaps = 1/106 (0%) Query: 52 QQHADYGYDHNSGKIHPDTAKYAHLKTVDYVAKPDYTYAYGVEDPHTGNLQNHKEQRDGD 111 Q A Y H++ I A+ +K+V++ A +Y ++Y V D HTG++++ E R GD Sbjct: 57 QHSAPAIYQHSAPAIVKTIAQPTIIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGD 116 Query: 112 VVRGEYSLVEPDGSVRLVRYTADPKNGFQAVVHKKAGGQAQA-PVH 156 V G+YSL++ DG R+V Y AD GF AVV ++ A PVH Sbjct: 117 EVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRREPSAVKIAHPVH 162 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 79.0 bits (186), Expect = 7e-17 Identities = 40/106 (37%), Positives = 61/106 (57%), Gaps = 1/106 (0%) Query: 52 QQHADYGYDHNSGKIHPDTAKYAHLKTVDYVAKPDYTYAYGVEDPHTGNLQNHKEQRDGD 111 Q A Y H++ I A+ +K+V++ A +Y ++Y V D HTG++++ E R GD Sbjct: 57 QHSAPAIYQHSAPAIVKTIAQPTIIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGD 116 Query: 112 VVRGEYSLVEPDGSVRLVRYTADPKNGFQAVVHKKAGG-QAQAPVH 156 V G+YSL++ DG R+V Y AD GF AVV ++ + PVH Sbjct: 117 EVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRREPSAVKIAQPVH 162 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 78.6 bits (185), Expect = 1e-16 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 1/99 (1%) Query: 59 YDHNSGKIHPDTAKYAHLKTVDYVAKPDYTYAYGVEDPHTGNLQNHKEQRDGDVVRGEYS 118 Y H++ I A+ +K+V++ A +Y ++Y V D HTG++++ E R GD V G+YS Sbjct: 56 YQHSAPAIVKTIAQPTIIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYS 115 Query: 119 LVEPDGSVRLVRYTADPKNGFQAVVHKKAGG-QAQAPVH 156 L++ DG R+V Y AD GF AVV ++ + PVH Sbjct: 116 LLDSDGHQRIVDYHADHHTGFNAVVRREPSAVKIAQPVH 154 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 78.6 bits (185), Expect = 1e-16 Identities = 40/106 (37%), Positives = 61/106 (57%), Gaps = 1/106 (0%) Query: 52 QQHADYGYDHNSGKIHPDTAKYAHLKTVDYVAKPDYTYAYGVEDPHTGNLQNHKEQRDGD 111 Q A Y H++ I A+ +K+V++ A +Y ++Y V D HTG++++ E R GD Sbjct: 57 QHSAPAIYQHSAPAIVKTIAQPTIIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGD 116 Query: 112 VVRGEYSLVEPDGSVRLVRYTADPKNGFQAVVHKKAGG-QAQAPVH 156 V G+YSL++ DG R+V Y AD GF AVV ++ + PVH Sbjct: 117 EVHGQYSLLDSDGHHRIVDYHADHHTGFNAVVRREPSAVKIAQPVH 162 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 68.1 bits (159), Expect = 1e-13 Identities = 29/49 (59%), Positives = 39/49 (79%) Query: 98 TGNLQNHKEQRDGDVVRGEYSLVEPDGSVRLVRYTADPKNGFQAVVHKK 146 TG+ ++ +E RDGDVV+G YS+V+PDG+ R V YTADP NGF AVV ++ Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNGFNAVVRRE 82 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 25.8 bits (54), Expect = 0.71 Identities = 13/47 (27%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Query: 12 LLATPAFTGKTGGYSYNRFSGPVSGQIVEVQVPAAEGIPAQQHADYG 58 + A TG TG Y + + + V VP++ +P H+ YG Sbjct: 11 MTAAVVATGNTGSYHQSAAAAAAAAANAPVYVPSSRALP---HSQYG 54 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 24.6 bits (51), Expect = 1.6 Identities = 11/37 (29%), Positives = 18/37 (48%) Query: 94 EDPHTGNLQNHKEQRDGDVVRGEYSLVEPDGSVRLVR 130 + N + EQR G + EY+ ++PD L+R Sbjct: 639 QSQENSNSVANSEQRYGTLPVAEYAAIKPDSLSTLIR 675 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.6 bits (46), Expect = 6.6 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 28 NRFSGPVSGQIVEVQVPAAEGIPAQQHADY 57 N ++G V I + +PA GIP ++ Y Sbjct: 421 NAYNGAVELMIPIIDIPAPFGIPIRKIIKY 450 >AF525673-3|AAM82612.1| 58|Anopheles gambiae cecropin CecC protein. Length = 58 Score = 22.2 bits (45), Expect = 8.8 Identities = 9/24 (37%), Positives = 14/24 (58%) Query: 7 IFVAILLATPAFTGKTGGYSYNRF 30 IF+ L+ AF G+T G + +F Sbjct: 6 IFLVALVLMAAFLGQTEGRRFKKF 29 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.315 0.135 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,777 Number of Sequences: 2123 Number of extensions: 8902 Number of successful extensions: 32 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 18 length of query: 170 length of database: 516,269 effective HSP length: 60 effective length of query: 110 effective length of database: 388,889 effective search space: 42777790 effective search space used: 42777790 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -