BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000244-TA|BGIBMGA000244-PA|IPR000061|SWAP/Surp, IPR000467|D111/G-patch, IPR006569|Regulation of nuclear pre-mRNA protein (816 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 75 3e-13 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 75 3e-13 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 75 3e-13 At5g26610.2 68418.m03181 D111/G-patch domain-containing protein ... 54 5e-07 At5g26610.1 68418.m03180 D111/G-patch domain-containing protein ... 54 5e-07 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 53 9e-07 At3g52120.1 68416.m05721 SWAP (Suppressor-of-White-APricot)/surp... 52 1e-06 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 48 3e-05 At5g23080.1 68418.m02698 SWAP (Suppressor-of-White-APricot)/surp... 47 4e-05 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 45 2e-04 At4g16200.1 68417.m02459 SWAP (Suppressor-of-White-APricot)/surp... 45 2e-04 At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing ... 40 0.007 At5g10800.1 68418.m01255 RNA recognition motif (RRM)-containing ... 40 0.007 At1g18050.1 68414.m02232 SWAP (Suppressor-of-White-APricot)/surp... 38 0.035 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 37 0.047 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 37 0.047 At1g05320.1 68414.m00539 myosin-related similar to non-muscle my... 37 0.047 At3g52350.1 68416.m05754 D111/G-patch domain-containing protein ... 36 0.082 At5g08535.2 68418.m01015 D111/G-patch domain-containing protein ... 36 0.11 At5g08535.1 68418.m01014 D111/G-patch domain-containing protein ... 36 0.11 At1g17070.1 68414.m02077 D111/G-patch domain-containing protein ... 36 0.11 At3g60380.1 68416.m06753 expressed protein 35 0.25 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 34 0.33 At5g40160.1 68418.m04874 ankyrin repeat family protein (EMB506) ... 34 0.44 At3g09850.1 68416.m01175 D111/G-patch domain-containing protein ... 33 0.58 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 33 0.76 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 33 0.76 At3g05270.1 68416.m00575 expressed protein similar to endosome-a... 32 1.3 At2g42330.1 68415.m05239 D111/G-patch domain-containing protein ... 32 1.3 At4g19570.1 68417.m02877 DNAJ heat shock N-terminal domain-conta... 32 1.8 At2g20960.1 68415.m02479 expressed protein pEARLI 4 gene product... 31 2.3 At1g15780.1 68414.m01893 expressed protein 31 2.3 At1g13790.1 68414.m01619 XH/XS domain-containing protein / XS zi... 31 2.3 At5g41790.1 68418.m05088 COP1-interactive protein 1 / CIP1 almos... 31 4.1 At1g27430.1 68414.m03343 GYF domain-containing protein contains ... 31 4.1 At5g06265.1 68418.m00701 hyaluronan mediated motility receptor-r... 30 5.4 At1g78815.1 68414.m09187 expressed protein contains Pfam profile... 30 5.4 At1g62220.1 68414.m07018 expressed protein 30 5.4 At5g07970.1 68418.m00926 dentin sialophosphoprotein-related cont... 30 7.1 At5g06520.1 68418.m00735 SWAP (Suppressor-of-White-APricot)/surp... 30 7.1 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 30 7.1 At3g15340.1 68416.m01936 expressed protein 30 7.1 At2g24830.1 68415.m02970 zinc finger (CCCH-type) family protein ... 30 7.1 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 29 9.4 At1g55080.1 68414.m06291 expressed protein 29 9.4 At1g31870.1 68414.m03917 expressed protein 29 9.4 At1g25540.1 68414.m03171 phytochrome and flowering time regulato... 29 9.4 >At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 74.5 bits (175), Expect = 3e-13 Identities = 29/56 (51%), Positives = 42/56 (75%) Query: 4 PQPPQDQDLRNIIDKLAQFVARNGPEFEKMTKNKQKNNPKFSFLYGGEYFNYYQYK 59 P PP D +L+ IDKL ++ +NGPEFE M +++QK+NP ++FL+GGE YY+YK Sbjct: 118 PPPPADPELQKRIDKLVEYSVKNGPEFEAMMRDRQKDNPDYAFLFGGEGHGYYRYK 173 Score = 39.9 bits (89), Expect = 0.007 Identities = 38/152 (25%), Positives = 70/152 (46%), Gaps = 14/152 (9%) Query: 209 TKDSISSGKGWILQHATSHDAGKVISQHLLRKVTQTGAAFTQKLHIIYLVNDVLHHCARK 268 TK+SI S K W +Q + A +++ L +V + Q +HI+YL ND+L ++ Sbjct: 285 TKESIKSAKIWFMQRSPFAPA---LAEALRDRVFAMDDSDRQ-MHIVYLANDILFDSLQR 340 Query: 269 NAEDLKKNLENVVVPMFCNASIA-------VTEEQEAKLNKLLRLWESKSNYFETAV--I 319 + + E + + + EE +++L K+L+ W SK + + + + Sbjct: 341 RTNLHEFDNEALAFRPILGSMLGRIYHFPQNKEENQSRLEKILQFWASKEVFDQDTISSL 400 Query: 320 EK-MKSPTSSYQDYQNALISQHANAISHLTQQ 350 EK MKS + + +I+ HA + QQ Sbjct: 401 EKEMKSGPPANTFSHSPIIAAHALQRPGMLQQ 432 >At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 74.5 bits (175), Expect = 3e-13 Identities = 29/56 (51%), Positives = 42/56 (75%) Query: 4 PQPPQDQDLRNIIDKLAQFVARNGPEFEKMTKNKQKNNPKFSFLYGGEYFNYYQYK 59 P PP D +L+ IDKL ++ +NGPEFE M +++QK+NP ++FL+GGE YY+YK Sbjct: 118 PPPPADPELQKRIDKLVEYSVKNGPEFEAMMRDRQKDNPDYAFLFGGEGHGYYRYK 173 Score = 39.9 bits (89), Expect = 0.007 Identities = 38/152 (25%), Positives = 70/152 (46%), Gaps = 14/152 (9%) Query: 209 TKDSISSGKGWILQHATSHDAGKVISQHLLRKVTQTGAAFTQKLHIIYLVNDVLHHCARK 268 TK+SI S K W +Q + A +++ L +V + Q +HI+YL ND+L ++ Sbjct: 285 TKESIKSAKIWFMQRSPFAPA---LAEALRDRVFAMDDSDRQ-MHIVYLANDILFDSLQR 340 Query: 269 NAEDLKKNLENVVVPMFCNASIA-------VTEEQEAKLNKLLRLWESKSNYFETAV--I 319 + + E + + + EE +++L K+L+ W SK + + + + Sbjct: 341 RTNLHEFDNEALAFRPILGSMLGRIYHFPQNKEENQSRLEKILQFWASKEVFDQDTISSL 400 Query: 320 EK-MKSPTSSYQDYQNALISQHANAISHLTQQ 350 EK MKS + + +I+ HA + QQ Sbjct: 401 EKEMKSGPPANTFSHSPIIAAHALQRPGMLQQ 432 >At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 74.5 bits (175), Expect = 3e-13 Identities = 29/56 (51%), Positives = 42/56 (75%) Query: 4 PQPPQDQDLRNIIDKLAQFVARNGPEFEKMTKNKQKNNPKFSFLYGGEYFNYYQYK 59 P PP D +L+ IDKL ++ +NGPEFE M +++QK+NP ++FL+GGE YY+YK Sbjct: 118 PPPPADPELQKRIDKLVEYSVKNGPEFEAMMRDRQKDNPDYAFLFGGEGHGYYRYK 173 Score = 39.9 bits (89), Expect = 0.007 Identities = 38/152 (25%), Positives = 70/152 (46%), Gaps = 14/152 (9%) Query: 209 TKDSISSGKGWILQHATSHDAGKVISQHLLRKVTQTGAAFTQKLHIIYLVNDVLHHCARK 268 TK+SI S K W +Q + A +++ L +V + Q +HI+YL ND+L ++ Sbjct: 285 TKESIKSAKIWFMQRSPFAPA---LAEALRDRVFAMDDSDRQ-MHIVYLANDILFDSLQR 340 Query: 269 NAEDLKKNLENVVVPMFCNASIA-------VTEEQEAKLNKLLRLWESKSNYFETAV--I 319 + + E + + + EE +++L K+L+ W SK + + + + Sbjct: 341 RTNLHEFDNEALAFRPILGSMLGRIYHFPQNKEENQSRLEKILQFWASKEVFDQDTISSL 400 Query: 320 EK-MKSPTSSYQDYQNALISQHANAISHLTQQ 350 EK MKS + + +I+ HA + QQ Sbjct: 401 EKEMKSGPPANTFSHSPIIAAHALQRPGMLQQ 432 >At5g26610.2 68418.m03181 D111/G-patch domain-containing protein contains Pfam PF01585: G-patch domain Length = 301 Score = 53.6 bits (123), Expect = 5e-07 Identities = 34/81 (41%), Positives = 44/81 (54%), Gaps = 8/81 (9%) Query: 738 IDSTNKGHQMLQKMGWSAGGLGASGQGIAEPISGGFVRDRQDQYKGVGVSLNDPY----E 793 I S+N G ++LQKMGW GLG QGI EPI G +RDR+ G+G D Y E Sbjct: 64 ISSSNVGFRLLQKMGWKGKGLGKQEQGITEPIKSG-IRDRR---LGLGKQEEDDYFTAEE 119 Query: 794 NFRKNKGAAFISRMKERALER 814 N ++ K I +E A +R Sbjct: 120 NIQRKKLDIEIEETEEIAKKR 140 >At5g26610.1 68418.m03180 D111/G-patch domain-containing protein contains Pfam PF01585: G-patch domain Length = 301 Score = 53.6 bits (123), Expect = 5e-07 Identities = 34/81 (41%), Positives = 44/81 (54%), Gaps = 8/81 (9%) Query: 738 IDSTNKGHQMLQKMGWSAGGLGASGQGIAEPISGGFVRDRQDQYKGVGVSLNDPY----E 793 I S+N G ++LQKMGW GLG QGI EPI G +RDR+ G+G D Y E Sbjct: 64 ISSSNVGFRLLQKMGWKGKGLGKQEQGITEPIKSG-IRDRR---LGLGKQEEDDYFTAEE 119 Query: 794 NFRKNKGAAFISRMKERALER 814 N ++ K I +E A +R Sbjct: 120 NIQRKKLDIEIEETEEIAKKR 140 >At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein similar to SP|Q15459 Splicing factor 3 subunit 1 (Spliceosome associated protein 114) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01805: Surp module Length = 785 Score = 52.8 bits (121), Expect = 9e-07 Identities = 25/56 (44%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Query: 11 DLRNIIDKLAQFVARNGPEFEKMTKNKQKNNPKFSFLYGGE-YFNYYQYKVTTEQA 65 D+R I++K AQFV++NG EFEK + N KF+FL + Y +YQ+K+T +A Sbjct: 67 DIRTIVEKTAQFVSKNGLEFEKRIIVSNEKNAKFNFLKSSDPYHAFYQHKLTEYRA 122 Score = 39.9 bits (89), Expect = 0.007 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Query: 1 MELPQPPQDQDLRNIIDKLAQFVARNGPEFEKMTKNKQKNNPKFSFL 47 + LP+ ++L +II AQFVARNG F N++ NNP+F F+ Sbjct: 180 VRLPEGITGEEL-DIIKLTAQFVARNGKSFLTGLSNRENNNPQFHFM 225 >At3g52120.1 68416.m05721 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein contains Pfam profiles PF01585: G-patch domain, PF01805: Surp module Length = 443 Score = 52.4 bits (120), Expect = 1e-06 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 2/66 (3%) Query: 4 PQPPQDQDLRNIIDKLAQFVARNGPEFEKMTKNKQKNNPKFSFLYGGEY--FNYYQYKVT 61 P PP D ++ + DKLA FVA++G FE +T+ K + F FL+ + YY +++ Sbjct: 131 PPPPSDPTVKKVADKLASFVAKHGRPFEHITRQKNPGDTPFKFLFDENCADYKYYVFRLA 190 Query: 62 TEQAIL 67 E+ ++ Sbjct: 191 EEEKLI 196 Score = 46.0 bits (104), Expect = 1e-04 Identities = 27/68 (39%), Positives = 39/68 (57%), Gaps = 11/68 (16%) Query: 738 IDSTNKGHQMLQKMGWSAG-GLGASGQGIAEPISGGFVRDRQDQYKGVGVSL-------N 789 I + N GH++L KMGW G G+G+S +G+A+PI G V+ GVG S + Sbjct: 358 IQADNVGHKLLSKMGWKEGEGIGSSRKGMADPIMAGDVKTNN---LGVGASAPGEVKPED 414 Query: 790 DPYENFRK 797 D YE ++K Sbjct: 415 DIYEQYKK 422 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 48.0 bits (109), Expect = 3e-05 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Query: 11 DLRNIIDKLAQFVARNGPEFEKMTKNKQKNNPKFSFLYG-GEYFNYYQYKVT 61 ++R I++ AQFV++NG F K ++ NN FSFL Y +Y+YKVT Sbjct: 66 EIRKIVETTAQFVSQNGLAFGNKVKTEKANNANFSFLKSDNPYHGFYRYKVT 117 Score = 35.9 bits (79), Expect = 0.11 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Query: 1 MELPQPPQDQDLRNIIDKLAQFVARNGPEFEKMTKNKQKNNPKFSFL 47 + LP+ + +L +II AQFVARNG F + ++ NN +F F+ Sbjct: 171 VRLPEGIMEAEL-DIIKHTAQFVARNGQSFLRELMRREVNNSQFQFM 216 >At5g23080.1 68418.m02698 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 930 Score = 47.2 bits (107), Expect = 4e-05 Identities = 23/63 (36%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Query: 2 ELPQPPQDQDLRNIIDKLAQFVARNGPEFEKMTKNKQKNNPKFSFLYGGEYFNYYQYKVT 61 E+P PP D +L+ +I+ A FV+R G +E +++ K ++N F FL G +YY ++ Sbjct: 393 EVP-PPADNNLKLLIEGFATFVSRCGKLYEDLSREKNQSNQLFDFLREGNGHDYYARRLW 451 Query: 62 TEQ 64 EQ Sbjct: 452 EEQ 454 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 45.2 bits (102), Expect = 2e-04 Identities = 27/83 (32%), Positives = 40/83 (48%), Gaps = 5/83 (6%) Query: 733 TTSGGIDSTNKGHQMLQKMGWSAG-GLGASGQGIAEPISGGFVRDRQDQYKGVGVSLNDP 791 T ID +N G++ML+ MGW G GLG G G+ EP+ V D+ G+G Sbjct: 1019 TEERAIDESNVGNRMLRNMGWHEGSGLGKDGSGMKEPVQAQGV----DRRAGLGSQQKKV 1074 Query: 792 YENFRKNKGAAFISRMKERALER 814 F G + + + ++AL R Sbjct: 1075 DAEFEVQPGDTYRTLLHKKALAR 1097 >At4g16200.1 68417.m02459 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam profile: PF01805 surp module Length = 288 Score = 44.8 bits (101), Expect = 2e-04 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Query: 1 MELPQPPQDQDLRNIIDKLAQFVARNGPEFEKMTKNKQKNNPKFSFL--YGGEYFNYYQY 58 ME+ PP D R ++DK AQFV++ G EFE + + KF+FL YY++ Sbjct: 12 MEIITPPADIGTRTLVDKAAQFVSKKGLEFETKIIDSYPTDAKFNFLRSTADPCHTYYKH 71 Query: 59 KV 60 K+ Sbjct: 72 KL 73 >At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing protein KIAA0332 - Homo sapiens, EMBL:AB002330 Length = 946 Score = 39.9 bits (89), Expect = 0.007 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Query: 7 PQDQDLRNIIDKLAQFVARNGPEFEKMTKNKQKNNPKFSFLY--GGEYFNYYQYKV 60 P+D+ LR++ID LA +V FE+ + + NP F F++ G + YY +++ Sbjct: 321 PEDEHLRHVIDTLALYVLDGECAFEQAIMERGRGNPLFKFMFELGSKEHTYYVWRL 376 >At5g10800.1 68418.m01255 RNA recognition motif (RRM)-containing protein KIAA0332 gene, Homo sapiens, EMBL:HSAB2330 Length = 947 Score = 39.9 bits (89), Expect = 0.007 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Query: 7 PQDQDLRNIIDKLAQFVARNGPEFEKMTKNKQKNNPKFSFLY--GGEYFNYYQYKV 60 P+D+ L+ IID +A V G FE+ + + NP F+FL+ G + YY +++ Sbjct: 328 PEDEHLKQIIDTMALNVLDGGCAFEQAIMERGRGNPLFNFLFELGSKEHTYYVWRL 383 >At1g18050.1 68414.m02232 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein weak similarity to spliceosome-associated-protein 114 [Echinococcus multilocularis] GI:11602721; contains Pfam profile PF01805: Surp module Length = 285 Score = 37.5 bits (83), Expect = 0.035 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Query: 13 RNIIDKLAQFVARNGPEFEKMTKNKQKNNPKFSFLYGGE-YFNYYQYKVTTEQ 64 R D A+ V GPE E+ NPK+SF + + Y YYQ K+ Q Sbjct: 151 RYYADSSARLVFMEGPEMERKMMTSYAGNPKYSFFWSSDRYHAYYQKKLAGYQ 203 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 37.1 bits (82), Expect = 0.047 Identities = 18/61 (29%), Positives = 32/61 (52%) Query: 7 PQDQDLRNIIDKLAQFVARNGPEFEKMTKNKQKNNPKFSFLYGGEYFNYYQYKVTTEQAI 66 P + L II + + FV+++G + E + + KQ +NP F FL + + Y + Q + Sbjct: 145 PPTEKLHQIITRTSSFVSKHGGQSEIVLRVKQGDNPTFGFLMPDHHLHLYFRFLVDHQEL 204 Query: 67 L 67 L Sbjct: 205 L 205 Score = 35.1 bits (77), Expect = 0.19 Identities = 19/68 (27%), Positives = 30/68 (44%) Query: 1 MELPQPPQDQDLRNIIDKLAQFVARNGPEFEKMTKNKQKNNPKFSFLYGGEYFNYYQYKV 60 +EL +++ +IDK+ F+ +NG E E + F FL ++ Y KV Sbjct: 324 LELQIVEPTTEMKRVIDKIVDFIQKNGKELEATLVAQDVKYGMFPFLRPSSLYHAYYRKV 383 Query: 61 TTEQAILK 68 E LK Sbjct: 384 LQEAEELK 391 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 37.1 bits (82), Expect = 0.047 Identities = 18/61 (29%), Positives = 32/61 (52%) Query: 7 PQDQDLRNIIDKLAQFVARNGPEFEKMTKNKQKNNPKFSFLYGGEYFNYYQYKVTTEQAI 66 P + L II + + FV+++G + E + + KQ +NP F FL + + Y + Q + Sbjct: 145 PPTEKLHQIITRTSSFVSKHGGQSEIVLRVKQGDNPTFGFLMPDHHLHLYFRFLVDHQEL 204 Query: 67 L 67 L Sbjct: 205 L 205 Score = 35.1 bits (77), Expect = 0.19 Identities = 19/68 (27%), Positives = 30/68 (44%) Query: 1 MELPQPPQDQDLRNIIDKLAQFVARNGPEFEKMTKNKQKNNPKFSFLYGGEYFNYYQYKV 60 +EL +++ +IDK+ F+ +NG E E + F FL ++ Y KV Sbjct: 324 LELQIVEPTTEMKRVIDKIVDFIQKNGKELEATLVAQDVKYGMFPFLRPSSLYHAYYRKV 383 Query: 61 TTEQAILK 68 E LK Sbjct: 384 LQEAEELK 391 >At1g05320.1 68414.m00539 myosin-related similar to non-muscle myosin II heavy chain (GI:19879404) [Loligo pealei]; ESTs gb|AA042402,gb|ATTS1380 come from this gene Length = 828 Score = 37.1 bits (82), Expect = 0.047 Identities = 51/259 (19%), Positives = 113/259 (43%), Gaps = 19/259 (7%) Query: 133 QEIDSITTQINVLKEQITQSENNLNAQHAVLIQQ--QQVKINELVSKAQMESLQIMADEN 190 ++ S T+ L E+ E + L + Q + + E + ++ E+ +++AD N Sbjct: 338 EDFSSRDTEAKSLTEKSKDLEEKIRVYEGKLAEACGQSLSLQEELDQSSAEN-ELLADTN 396 Query: 191 N---INLSELDNILQPIIDSCTK--DSISSGKGWILQHATSHDAGKVISQHLLRKVTQTG 245 N I + EL+ L ++ + + + ++ SH+ VI +H + + +G Sbjct: 397 NQLKIKIQELEGYLDSEKETAIEKLNQKDTEAKDLITKLKSHE--NVIEEHKRQVLEASG 454 Query: 246 AAFTQKLHIIYLVNDVLHHCARKNAEDLKK-NLENVVVPMFCNASIA----VTEEQEAKL 300 A T+K+ + + + + E+L+K N + V + N +A T++ +AKL Sbjct: 455 VADTRKVEVEEALLKL--NTLESTIEELEKENGDLAEVNIKLNQKLANQGSETDDFQAKL 512 Query: 301 NKLLRLWESKSNYFETAVIEKMKSPTSSYQDYQNALIS--QHANAISHLTQQTKSTFENY 358 + L ++ + + + K TS + ++ + S + N ++ + Q TK+ Sbjct: 513 SVLEAEKYQQAKELQITIEDLTKQLTSERERLRSQISSLEEEKNQVNEIYQSTKNELVKL 572 Query: 359 QSQHQAFVGHTMQQIQQLE 377 Q+Q Q + + Q+E Sbjct: 573 QAQLQVDKSKSDDMVSQIE 591 >At3g52350.1 68416.m05754 D111/G-patch domain-containing protein contains Pfam profile PF01585: G-patch domain Length = 180 Score = 36.3 bits (80), Expect = 0.082 Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Query: 735 SGGIDSTNKGHQMLQKMGWSAG-GLGASGQGIAEPI 769 S I S+N G Q+L+K GW G GLG + QGI P+ Sbjct: 74 STAISSSNIGFQLLKKHGWKEGTGLGITEQGILVPL 109 >At5g08535.2 68418.m01015 D111/G-patch domain-containing protein contains Pfam profile PF01585: G-patch domain; contains a 2nt micro-exon, as identified using GeneSeqer. Length = 116 Score = 35.9 bits (79), Expect = 0.11 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Query: 738 IDSTNKGHQMLQKMGWSAG-GLGASGQGIAEPI 769 I+S+N G Q+L+K GW G GLG + QGI P+ Sbjct: 14 INSSNIGFQLLKKHGWKEGTGLGIAEQGILVPL 46 >At5g08535.1 68418.m01014 D111/G-patch domain-containing protein contains Pfam profile PF01585: G-patch domain; contains a 2nt micro-exon, as identified using GeneSeqer. Length = 141 Score = 35.9 bits (79), Expect = 0.11 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Query: 738 IDSTNKGHQMLQKMGWSAG-GLGASGQGIAEPI 769 I+S+N G Q+L+K GW G GLG + QGI P+ Sbjct: 39 INSSNIGFQLLKKHGWKEGTGLGIAEQGILVPL 71 >At1g17070.1 68414.m02077 D111/G-patch domain-containing protein Similar to SP|Q9ERA6 Tuftelin-interacting protein 11 {Mus musculus}; contains Pfam profile PF01585: G-patch domain Length = 849 Score = 35.9 bits (79), Expect = 0.11 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 6/47 (12%) Query: 744 GHQMLQKMGWSAGGLGASGQGIAEPISGGFVRDRQDQYKGVGVSLND 790 G ++L+KMG+ GGLG + QGI PI + Q + K +G+ ND Sbjct: 204 GMKLLEKMGYKGGGLGKNQQGIVAPI------EAQLRPKNMGMGYND 244 >At3g60380.1 68416.m06753 expressed protein Length = 743 Score = 34.7 bits (76), Expect = 0.25 Identities = 23/97 (23%), Positives = 45/97 (46%), Gaps = 3/97 (3%) Query: 400 MGNFHNSNFSDIGYPQ-MGGYDQNFNANSNSQ-QYGSESGDNYPTNNSISGNE-NSYDSQ 456 +G+ + SNF I + + +S+SQ Y S++ + + + S+S NS + Sbjct: 266 IGDNYPSNFQPISVDETLKSISSRSTGSSSSQTSYASQNQNRFSPSRSVSAESLNSNVEE 325 Query: 457 IFEQIAKQKKENIEDPDLSNLPNVNFSVPPPGFKPLD 493 + ++ ++Q P L P+++ S P P P D Sbjct: 326 LVKEKSRQSSSRSSSPSLPPSPSLSPSPPSPELVPND 362 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 34.3 bits (75), Expect = 0.33 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Query: 592 GWEKLGLYEYYKAKNSARKMKEDAIAQGYRQKSKSPSPIPKDLQKQPTPPGRR-YRSRSK 650 G L YE ++ + AR+ + G R++S+S S P +K PT GRR Y R++ Sbjct: 92 GGSDLKCYECGESGHFARECRSRG-GSGGRRRSRSRSRSPPRYRKSPTYGGRRSYSPRAR 150 Query: 651 TPEP 654 +P P Sbjct: 151 SPPP 154 >At5g40160.1 68418.m04874 ankyrin repeat family protein (EMB506) identical to ankyrin repeat protein EMB506 [Arabidopsis thaliana] GI:5911312; contains ankyrin repeats, Pfam:PF00023 Length = 315 Score = 33.9 bits (74), Expect = 0.44 Identities = 29/106 (27%), Positives = 48/106 (45%), Gaps = 6/106 (5%) Query: 135 IDSITTQINVLKEQITQSENNLNAQHAVLIQQQQVKINELVSKAQMESLQIMADENNINL 194 + +TT N +E + E L + V++QQ + +++S + LQ +A I L Sbjct: 108 VQKLTTTDNYEEELAKEVEQLLEPEERVILQQNEKPNLKMISTKSWKPLQTLALSMQIQL 167 Query: 195 SELDNILQPIIDSCTKDSISSGKGWILQHATSHDAGKVISQHLLRK 240 +DN+++ +D D + L A VIS HLLRK Sbjct: 168 --MDNLIENGLDI---DDVDKDNQTALHKAIIGKKEAVIS-HLLRK 207 >At3g09850.1 68416.m01175 D111/G-patch domain-containing protein contains Pfam profile PF01585: G-patch domain Length = 781 Score = 33.5 bits (73), Expect = 0.58 Identities = 15/27 (55%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Query: 744 GHQMLQKMGW-SAGGLGASGQGIAEPI 769 G +M+ KMG+ GGLG G+GIA+PI Sbjct: 639 GSKMMAKMGFIDGGGLGKDGKGIAQPI 665 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 33.1 bits (72), Expect = 0.76 Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 2/34 (5%) Query: 623 KSKSPSPIPKDLQKQPTPPGRRYRSRSKTPEPNI 656 KS S SP P+ + P+P RR RSRS++P P++ Sbjct: 247 KSTSRSPGPRSKSRSPSP--RRSRSRSRSPLPSV 278 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 33.1 bits (72), Expect = 0.76 Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 2/34 (5%) Query: 623 KSKSPSPIPKDLQKQPTPPGRRYRSRSKTPEPNI 656 KS S SP P+ + P+P RR RSRS++P P++ Sbjct: 247 KSTSRSPGPRSKSRSPSP--RRSRSRSRSPLPSV 278 >At3g05270.1 68416.m00575 expressed protein similar to endosome-associated protein (EEA1) (GI:1016368) [Homo sapiens]; similar to smooth muscle myosin heavy chain (GI:4417214) [Homo sapiens; contains Pfam profile PF05911: Plant protein of unknown function (DUF869) Length = 615 Score = 32.3 bits (70), Expect = 1.3 Identities = 17/58 (29%), Positives = 32/58 (55%) Query: 141 QINVLKEQITQSENNLNAQHAVLIQQQQVKINELVSKAQMESLQIMADENNINLSELD 198 QI L+ ++ + E L+ + + Q++++ S QME LQ ++ +NLSEL+ Sbjct: 382 QIEALQSRLKEIEGKLSEMKKLEAENQELELLLGESGKQMEDLQRQLNKAQVNLSELE 439 >At2g42330.1 68415.m05239 D111/G-patch domain-containing protein similar to SP|Q9ERA6 Tuftelin-interacting protein 11 {Mus musculus}; contains Pfam profile PF01585: G-patch domain Length = 752 Score = 32.3 bits (70), Expect = 1.3 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 11/56 (19%) Query: 735 SGGIDSTNKGHQMLQKMGWSAGGLGASGQGIAEPISGGFVRDRQDQYKGVGVSLND 790 SGGI G ++L+KMG+ GLG + QGI PI + Q + K +G+ ND Sbjct: 103 SGGI-----GMKLLEKMGYKGRGLGKNQQGIVAPI------EVQLRPKNMGMGYND 147 >At4g19570.1 68417.m02877 DNAJ heat shock N-terminal domain-containing protein low similarity to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 558 Score = 31.9 bits (69), Expect = 1.8 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 6/63 (9%) Query: 602 YKAKNSARKMKEDAIAQGYRQKSKSPSPIPKDLQKQ---PTPPGR---RYRSRSKTPEPN 655 Y K + ++K+ ++S +P P D PTPP + R R PEP+ Sbjct: 126 YDQKRKSNQVKQRTSGMQKPKRSSTPKPTESDKPASSYGPTPPPEPRPKRRPRPNIPEPD 185 Query: 656 IPM 658 IPM Sbjct: 186 IPM 188 >At2g20960.1 68415.m02479 expressed protein pEARLI 4 gene product [Arabidopsis thaliana] GI:871782 Length = 748 Score = 31.5 bits (68), Expect = 2.3 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Query: 625 KSPSPIPKDLQKQPT---PPGRRYRSRSKTPEPN 655 +SP P K + QPT P R + RSKTPEP+ Sbjct: 308 RSPGPRSKTPEPQPTYFEPSSRTPKQRSKTPEPS 341 >At1g15780.1 68414.m01893 expressed protein Length = 1335 Score = 31.5 bits (68), Expect = 2.3 Identities = 18/69 (26%), Positives = 30/69 (43%) Query: 319 IEKMKSPTSSYQDYQNALISQHANAISHLTQQTKSTFENYQSQHQAFVGHTMQQIQQLEM 378 + ++S + Q + L QH Q K F+ Q Q Q QQ QQL+ Sbjct: 808 LSTLQSNVNQPQLSSSLLQHQHLKQQQDQQMQLKQQFQQRQMQQQQLQARQQQQQQQLQA 867 Query: 379 QKHALEMQK 387 ++ A ++Q+ Sbjct: 868 RQQAAQLQQ 876 >At1g13790.1 68414.m01619 XH/XS domain-containing protein / XS zinc finger domain-containing protein contains Pfam domains PF03469: XH domain, PF03468: XS domain and PF03470: XS zinc finger domain Length = 736 Score = 31.5 bits (68), Expect = 2.3 Identities = 34/124 (27%), Positives = 54/124 (43%), Gaps = 17/124 (13%) Query: 268 KNAEDLKK------NLENVVVPMFCNASI--AVTEEQEAKLNKLLRLWESKSNYFETAVI 319 K AED +K NLEN +V N ++ ++ + L K ++ + N Sbjct: 350 KEAEDQRKTFTLVSNLENTLVTKSDNLQQMESIYKQTSSVLEKRMKEKDEMINTHN---- 405 Query: 320 EKMKSPTSSYQDYQNALISQHANAISHLTQQTK--STFENYQSQHQAFVGHTMQQIQQLE 377 EKM + +DY ++ +H A HL Q K ENY + QA + ++L+ Sbjct: 406 EKMSIMQQTARDYLASIYEEHEKASQHLEAQRKEYEDRENYLDKCQA---KNKTERRKLQ 462 Query: 378 MQKH 381 QKH Sbjct: 463 WQKH 466 >At5g41790.1 68418.m05088 COP1-interactive protein 1 / CIP1 almost identical to CIP1 (GI:836950) [Arabidopsis thaliana] Length = 1305 Score = 30.7 bits (66), Expect = 4.1 Identities = 17/72 (23%), Positives = 34/72 (47%), Gaps = 3/72 (4%) Query: 128 LPQHPQEIDSITTQINVLKEQITQSENNLNA---QHAVLIQQQQVKINELVSKAQMESLQ 184 L Q ++ + T++ K+ +TQ EN L++ H + ++ EL ++ + Q Sbjct: 529 LKQAQSKVQELVTELAESKDTLTQKENELSSFVEVHEAHKRDSSSQVKELEARVESAEEQ 588 Query: 185 IMADENNINLSE 196 + N+N SE Sbjct: 589 VKELNQNLNSSE 600 >At1g27430.1 68414.m03343 GYF domain-containing protein contains Pfam profile: PF02213 GYF domain Length = 1531 Score = 30.7 bits (66), Expect = 4.1 Identities = 26/115 (22%), Positives = 51/115 (44%), Gaps = 8/115 (6%) Query: 276 NLENVVVPMFCNASIAVTEEQEAKLNKLLRLWESKSNYFETAVIEKMKSPTSSYQDYQNA 335 ++EN + N+ I +A + +E +SN+F +++ S Q +QN Sbjct: 710 SIENRPINSRRNSQIDPNISLDALSGNRMSQFEHESNFFNHG--DQLPSNQHHQQHFQNR 767 Query: 336 LISQHANA----ISHLTQQTKSTFENYQSQHQAFVGHTMQQIQQLEMQKHALEMQ 386 + H + + HL + Q Q Q + +QQ Q++++Q+H LE + Sbjct: 768 DMLSHLHIGDQDLEHLITLQLQQQQKIQMQQQQKI--QLQQQQKIQLQQHQLEQE 820 >At5g06265.1 68418.m00701 hyaluronan mediated motility receptor-related contains weak similarity to hyaluronan mediated motility receptor (Intracellular hyaluronic acid binding protein) (Receptor for hyaluronan-mediated motility) (CD168 antigen) (Swiss-Prot:O75330) [Homo sapiens] Length = 106 Score = 30.3 bits (65), Expect = 5.4 Identities = 17/61 (27%), Positives = 37/61 (60%), Gaps = 3/61 (4%) Query: 146 KEQITQSENNLNAQHAVLIQQQQV-KINELVSKAQMESLQIMADENNINLSELDNILQPI 204 ++ I Q + ++ + +L Q++++ K+NELV + + LQ +EN + L+EL+ L + Sbjct: 44 QQHIPQGKESVQVKK-ILFQEKKIQKLNELVRDLRRQLLQ-CRNENQVELTELETELDQL 101 Query: 205 I 205 + Sbjct: 102 L 102 >At1g78815.1 68414.m09187 expressed protein contains Pfam profile PF04852: Protein of unknown function (DUF640) Length = 195 Score = 30.3 bits (65), Expect = 5.4 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Query: 612 KEDAIAQGYRQKSKSPSPIPKDLQKQPTPPG-RRYRSRSK 650 K IA+G Q P P P Q P PP RY S+ + Sbjct: 7 KGKGIAEGSSQPQSQPQPQPHQPQSPPNPPALSRYESQKR 46 >At1g62220.1 68414.m07018 expressed protein Length = 153 Score = 30.3 bits (65), Expect = 5.4 Identities = 16/50 (32%), Positives = 23/50 (46%) Query: 426 NSNSQQYGSESGDNYPTNNSISGNENSYDSQIFEQIAKQKKENIEDPDLS 475 +S+S Y S +G N P + EN Y S + IAK +K + S Sbjct: 56 SSSSDVYSSATGFNNPKGPDANAYENGYTSTSGQVIAKGRKARVSSASAS 105 >At5g07970.1 68418.m00926 dentin sialophosphoprotein-related contains weak similarity to Swiss-Prot:Q9NZW4 dentin sialophosphoprotein precursor [Homo sapiens] Length = 1097 Score = 29.9 bits (64), Expect = 7.1 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Query: 146 KEQITQSENNLNAQHAVLIQQQQVKINELVSKAQMESLQIMA-DENNINLS-ELDNILQP 203 ++Q+T ++ L QHA+ Q + +I + + K Q+E+ Q+ + N +N S DN P Sbjct: 179 RQQMTFNDMQLLKQHAMAKQMHEYQIQQQLQKQQLEARQLNSLHSNAVNGSLSSDNQSHP 238 Query: 204 II 205 I Sbjct: 239 SI 240 >At5g06520.1 68418.m00735 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam profile: PF01805 surp module Length = 679 Score = 29.9 bits (64), Expect = 7.1 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Query: 15 IIDKLAQFVARNGPEFEKMTKNKQKNNPKFSFL--YGGEYFNYYQYKVTTEQAIL 67 II AQF+AR G F + + + NP+F FL F++Y V +L Sbjct: 490 IIKLTAQFMARYGMNFVQGLRKRVVGNPQFKFLESTNNSRFSFYNGLVIAYSRVL 544 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 29.9 bits (64), Expect = 7.1 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 3/37 (8%) Query: 618 QGYRQKSKSPSPIPKDLQKQPTPPGRRYRSRSKTPEP 654 + Y +++SP P P+ ++ P+PP R RS S++P P Sbjct: 144 RSYSPRARSPPP-PR--RRSPSPPPARGRSYSRSPPP 177 Score = 29.5 bits (63), Expect = 9.4 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 2/67 (2%) Query: 588 RDNEGWEKLGLYEYYKAKNSARKMKEDAIAQGYRQKSKSPSPIPKDLQKQPTPPGRRYRS 647 R G L YE + + AR+ + G R++SKS S P ++ P+ R Y Sbjct: 91 RGGRGGSDLKCYECGETGHFARECRNRG-GTG-RRRSKSRSRTPPRYRRSPSYGRRSYSP 148 Query: 648 RSKTPEP 654 R+++P P Sbjct: 149 RARSPPP 155 >At3g15340.1 68416.m01936 expressed protein Length = 487 Score = 29.9 bits (64), Expect = 7.1 Identities = 14/36 (38%), Positives = 24/36 (66%) Query: 121 VNSAPPPLPQHPQEIDSITTQINVLKEQITQSENNL 156 V S L + +E+D+IT +IN L +++ +S+NNL Sbjct: 218 VKSMAVELNEVKKELDAITWKINHLSDKVGKSQNNL 253 >At2g24830.1 68415.m02970 zinc finger (CCCH-type) family protein / D111/G-patch domain-containing protein contains Pfam profiles PF01585: G-patch domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 497 Score = 29.9 bits (64), Expect = 7.1 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Query: 746 QMLQKMGWSAG-GLGASGQGIAEPI 769 +M+ MG+ G GLG SGQGI PI Sbjct: 306 KMMASMGYREGMGLGVSGQGILNPI 330 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 29.5 bits (63), Expect = 9.4 Identities = 12/26 (46%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Query: 622 QKSKSPSPIPKDLQKQPTPPGRRYRS 647 ++ +SPSP P ++ P+PP RR+RS Sbjct: 318 RRRRSPSP-PARRRRSPSPPARRHRS 342 >At1g55080.1 68414.m06291 expressed protein Length = 244 Score = 29.5 bits (63), Expect = 9.4 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Query: 346 HLTQQTKSTFENYQSQHQAFVGHTMQQIQQLEMQKHALEMQK 387 HL QQ ++ + Q Q Q MQQ QQ + Q+H ++ Q+ Sbjct: 53 HLQQQQQT--QQQQQQFQPQQQQEMQQYQQFQQQQHFIQQQQ 92 >At1g31870.1 68414.m03917 expressed protein Length = 561 Score = 29.5 bits (63), Expect = 9.4 Identities = 23/72 (31%), Positives = 29/72 (40%), Gaps = 10/72 (13%) Query: 589 DNEGWEKLGLYEYYKAKNSARKMKEDAIAQGYRQKSKSPSPIPKD-----LQKQPTPPGR 643 D GW L L N + + Q R S SP P P+ + +PP R Sbjct: 98 DGSGWVTLPLNREDTQSNISPPRR-----QRTRNDSPSPEPGPRRSVADRVDTDMSPPRR 152 Query: 644 RYRSRSKTPEPN 655 R R S +PEPN Sbjct: 153 RKRHNSPSPEPN 164 >At1g25540.1 68414.m03171 phytochrome and flowering time regulatory protein (PFT1) PMID: 12815435 Length = 836 Score = 29.5 bits (63), Expect = 9.4 Identities = 18/58 (31%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Query: 330 QDYQNALISQHANAISHLTQQTKSTFENYQSQHQAFVGHTMQQIQQLEMQKHALEMQK 387 Q Q I Q HL QQ + Q QHQ QQ Q ++Q H + Q+ Sbjct: 692 QQQQQQQIQQQQQQQQHLQQQQMPQLQQQQQQHQQ---QQQQQHQLSQLQHHQQQQQQ 746 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.312 0.129 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,904,724 Number of Sequences: 28952 Number of extensions: 681805 Number of successful extensions: 2070 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 23 Number of HSP's that attempted gapping in prelim test: 2002 Number of HSP's gapped (non-prelim): 90 length of query: 816 length of database: 12,070,560 effective HSP length: 87 effective length of query: 729 effective length of database: 9,551,736 effective search space: 6963215544 effective search space used: 6963215544 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 63 (29.5 bits)
- SilkBase 1999-2023 -