BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000242-TA|BGIBMGA000242-PA|IPR010703|Dedicator of cytokinesis (754 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 32 0.048 Z49833-1|CAA89994.1| 250|Anopheles gambiae serine proteinase pr... 25 9.7 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 32.3 bits (70), Expect = 0.048 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Query: 156 AGCTLLLYAETLSWDSDQTGVDSEHPD-TPEWKRKEALYNQV 196 A TLL+ ETL WD T S HPD PE + +Y +V Sbjct: 200 ASRTLLMNIETLHWDPLLTKTFSVHPDMLPEIRSSSEIYGKV 241 >Z49833-1|CAA89994.1| 250|Anopheles gambiae serine proteinase protein. Length = 250 Score = 24.6 bits (51), Expect = 9.7 Identities = 9/20 (45%), Positives = 15/20 (75%) Query: 716 MSEPLRVGDDEIPPPIPPKG 735 +SEP+ +G+ IP +PP+G Sbjct: 105 LSEPVPLGETIIPVCLPPEG 124 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.135 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 758,276 Number of Sequences: 2123 Number of extensions: 31610 Number of successful extensions: 42 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 40 Number of HSP's gapped (non-prelim): 2 length of query: 754 length of database: 516,269 effective HSP length: 69 effective length of query: 685 effective length of database: 369,782 effective search space: 253300670 effective search space used: 253300670 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -