BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000241-TA|BGIBMGA000241-PA|IPR008973|C2 calcium/lipid-binding region, CaLB (986 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0208 + 28412736-28415348 31 3.4 05_04_0335 - 20354678-20354686,20354819-20355662,20355739-20356217 30 7.9 >05_07_0208 + 28412736-28415348 Length = 870 Score = 31.5 bits (68), Expect = 3.4 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 2/78 (2%) Query: 230 LGAGVLSLADFLRQTGQHPAEKEYTFKVYQCEEKEFHQLHDMLIRKQTNKCNILPGQPNY 289 LG LSL + + + G+HP E + + C L T K +I+P +Y Sbjct: 580 LGDIALSLFNQMVEMGEHPDEVTFVALLCACSRAGMVIQGWELFHMMTEKFSIVPNLKHY 639 Query: 290 GIVVALRLLANSGSVTEA 307 +V LL+ G +TEA Sbjct: 640 ACMV--DLLSRVGKLTEA 655 >05_04_0335 - 20354678-20354686,20354819-20355662,20355739-20356217 Length = 443 Score = 30.3 bits (65), Expect = 7.9 Identities = 21/73 (28%), Positives = 30/73 (41%), Gaps = 2/73 (2%) Query: 235 LSLADFLRQTGQHPAEKEYTFKVYQCEEKEFHQLHDMLIRKQTNKCNILPGQPNYGIVVA 294 L+L D + G P + + +Y C Q L N+ I PG +Y Sbjct: 197 LALYDRMVLAGAKPNKVTFVGLIYACSHAGLVQKGRQLFESMKNEYGITPGLQHY--TCY 254 Query: 295 LRLLANSGSVTEA 307 L LL+ SG + EA Sbjct: 255 LDLLSRSGHLLEA 267 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.323 0.135 0.413 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,665,848 Number of Sequences: 37544 Number of extensions: 1109789 Number of successful extensions: 2510 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 2510 Number of HSP's gapped (non-prelim): 2 length of query: 986 length of database: 14,793,348 effective HSP length: 89 effective length of query: 897 effective length of database: 11,451,932 effective search space: 10272383004 effective search space used: 10272383004 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -