BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000241-TA|BGIBMGA000241-PA|IPR008973|C2 calcium/lipid-binding region, CaLB (986 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 24 4.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 24 4.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 24 4.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 24 4.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 24 4.4 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 24.2 bits (50), Expect = 4.4 Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 581 VLISICSLLDESRFQHFKPVLDV 603 ++ S L D+SR +H +P LDV Sbjct: 52 LIYSFVGLGDDSRIKHLEPNLDV 74 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 24.2 bits (50), Expect = 4.4 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 7/65 (10%) Query: 508 STKLTQNEDLLALL-----QWRAHPEKVQETLLRVLRLGDGLSCEELI-KFLRDVLDALF 561 S K +N D + + W + E++ E L +LRL + S + K+LR V+D + Sbjct: 550 SAKAVKNSDHITRIYACATMWHENKEEMMEFLKSILRLDEDQSARRVAQKYLR-VVDPDY 608 Query: 562 ALFST 566 F T Sbjct: 609 YEFET 613 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 24.2 bits (50), Expect = 4.4 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 7/65 (10%) Query: 508 STKLTQNEDLLALL-----QWRAHPEKVQETLLRVLRLGDGLSCEELI-KFLRDVLDALF 561 S K +N D + + W + E++ E L +LRL + S + K+LR V+D + Sbjct: 550 SAKAVKNSDHITRIYACATMWHENKEEMMEFLKSILRLDEDQSARRVAQKYLR-VVDPDY 608 Query: 562 ALFST 566 F T Sbjct: 609 YEFET 613 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 24.2 bits (50), Expect = 4.4 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 7/65 (10%) Query: 508 STKLTQNEDLLALL-----QWRAHPEKVQETLLRVLRLGDGLSCEELI-KFLRDVLDALF 561 S K +N D + + W + E++ E L +LRL + S + K+LR V+D + Sbjct: 550 SAKAVKNSDHITRIYACATMWHENKEEMMEFLKSILRLDEDQSARRVAQKYLR-VVDPDY 608 Query: 562 ALFST 566 F T Sbjct: 609 YEFET 613 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 24.2 bits (50), Expect = 4.4 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 7/65 (10%) Query: 508 STKLTQNEDLLALL-----QWRAHPEKVQETLLRVLRLGDGLSCEELI-KFLRDVLDALF 561 S K +N D + + W + E++ E L +LRL + S + K+LR V+D + Sbjct: 550 SAKAVKNSDHITRIYACATMWHENKEEMMEFLKSILRLDEDQSARRVAQKYLR-VVDPDY 608 Query: 562 ALFST 566 F T Sbjct: 609 YEFET 613 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.323 0.135 0.413 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,555 Number of Sequences: 317 Number of extensions: 8384 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 15 Number of HSP's gapped (non-prelim): 5 length of query: 986 length of database: 114,650 effective HSP length: 63 effective length of query: 923 effective length of database: 94,679 effective search space: 87388717 effective search space used: 87388717 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -