BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000239-TA|BGIBMGA000239-PA|IPR002007|Haem peroxidase, animal, IPR010255|Haem peroxidase (429 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 24 1.8 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 24.2 bits (50), Expect = 1.8 Identities = 15/47 (31%), Positives = 19/47 (40%) Query: 235 YQATGKADSTVDPDISDIGLGPVQEVFDIPTTDLAKGRYFGLPSYTK 281 ++ K+ P SD+ L PV E I T LA LP K Sbjct: 221 FEVPTKSSPRSSPVQSDVSLSPVHEPLLITTEKLAAEGQTKLPQQPK 267 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,368 Number of Sequences: 317 Number of extensions: 4502 Number of successful extensions: 7 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 1 length of query: 429 length of database: 114,650 effective HSP length: 59 effective length of query: 370 effective length of database: 95,947 effective search space: 35500390 effective search space used: 35500390 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -