GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000239-TA|BGIBMGA000239-PA|IPR002007|Haem peroxidase,
animal, IPR010255|Haem peroxidase
         (429 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U77974-1|AAB36556.1|  276|Tribolium castaneum transcription fact...    24   1.8  

>U77974-1|AAB36556.1|  276|Tribolium castaneum transcription factor
           homolog protein.
          Length = 276

 Score = 24.2 bits (50), Expect = 1.8
 Identities = 15/47 (31%), Positives = 19/47 (40%)

Query: 235 YQATGKADSTVDPDISDIGLGPVQEVFDIPTTDLAKGRYFGLPSYTK 281
           ++   K+     P  SD+ L PV E   I T  LA      LP   K
Sbjct: 221 FEVPTKSSPRSSPVQSDVSLSPVHEPLLITTEKLAAEGQTKLPQQPK 267


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.320    0.136    0.412 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 103,368
Number of Sequences: 317
Number of extensions: 4502
Number of successful extensions: 7
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 6
Number of HSP's gapped (non-prelim): 1
length of query: 429
length of database: 114,650
effective HSP length: 59
effective length of query: 370
effective length of database: 95,947
effective search space: 35500390
effective search space used: 35500390
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 44 (21.8 bits)