GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000238-TA|BGIBMGA000238-PA|IPR002007|Haem peroxidase,
animal, IPR010255|Haem peroxidase
         (485 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY675073-1|AAV74190.1|  533|Tribolium castaneum chitinase 5 prot...    23   3.6  
U77974-1|AAB36556.1|  276|Tribolium castaneum transcription fact...    23   6.3  

>AY675073-1|AAV74190.1|  533|Tribolium castaneum chitinase 5
           protein.
          Length = 533

 Score = 23.4 bits (48), Expect = 3.6
 Identities = 8/12 (66%), Positives = 9/12 (75%)

Query: 241 YYEFLPEVLGKD 252
           YYE  PE+L KD
Sbjct: 309 YYEICPEILNKD 320


>U77974-1|AAB36556.1|  276|Tribolium castaneum transcription factor
           homolog protein.
          Length = 276

 Score = 22.6 bits (46), Expect = 6.3
 Identities = 15/47 (31%), Positives = 18/47 (38%)

Query: 338 YQATGKGDSSVDPDITDVGLGPVQEIFDIPTADLAKGRYFGLPSYTK 384
           ++   K      P  +DV L PV E   I T  LA      LP   K
Sbjct: 221 FEVPTKSSPRSSPVQSDVSLSPVHEPLLITTEKLAAEGQTKLPQQPK 267


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.321    0.137    0.419 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 120,331
Number of Sequences: 317
Number of extensions: 5328
Number of successful extensions: 7
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 2
length of query: 485
length of database: 114,650
effective HSP length: 59
effective length of query: 426
effective length of database: 95,947
effective search space: 40873422
effective search space used: 40873422
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 45 (22.2 bits)