BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000237-TA|BGIBMGA000237-PA|undefined (1018 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 25 2.0 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 24 6.0 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 24 6.0 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 23 8.0 AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII pr... 23 8.0 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 25.4 bits (53), Expect = 2.0 Identities = 31/113 (27%), Positives = 44/113 (38%), Gaps = 5/113 (4%) Query: 732 KCQLMESLLQTPTNASE----MEYMNDIPRQSEPQHAKETIVRDNQTHRELSPKTFVRVQ 787 K L + LL PT +E MN + AKE+I + + P RV+ Sbjct: 681 KNMLSDELLAQPTIKENFHTALEIMNRAVNIGQQPGAKESISYLSMENNAPPPPPPPRVE 740 Query: 788 KENTLIVNVAKIEDRISNLEAKR-PERKTSRDKMNERQMKVKQVIEIPLQRLQ 839 + V+KI +L AKR ER + + + KQV I LQ Sbjct: 741 SFAETVRTVSKIPPLYKDLVAKRCEERGILFVPIPNKYYEAKQVYRIGSNGLQ 793 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/35 (28%), Positives = 19/35 (54%) Query: 687 YMKSKNLEILDRHYIGKPGNLKLDNYQFDPMIVPP 721 Y +++N+ + Y GK G + ++Y DP + P Sbjct: 418 YYQNENMLQKNAEYSGKVGYYENNHYNGDPNYISP 452 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/35 (28%), Positives = 19/35 (54%) Query: 687 YMKSKNLEILDRHYIGKPGNLKLDNYQFDPMIVPP 721 Y +++N+ + Y GK G + ++Y DP + P Sbjct: 366 YYQNENMLQKNAEYSGKVGYYENNHYNGDPNYISP 400 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/31 (29%), Positives = 15/31 (48%) Query: 737 ESLLQTPTNASEMEYMNDIPRQSEPQHAKET 767 + L Q+ T + Y + P S PQH+ + Sbjct: 21 QQLFQSATTEAPAAYSSSSPSGSSPQHSSSS 51 >AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII protein. Length = 209 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/31 (29%), Positives = 15/31 (48%) Query: 737 ESLLQTPTNASEMEYMNDIPRQSEPQHAKET 767 + L Q+ T + Y + P S PQH+ + Sbjct: 21 QQLFQSATTEAPAAYSSSSPSGSSPQHSSSS 51 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.132 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 221,167 Number of Sequences: 317 Number of extensions: 9178 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 5 length of query: 1018 length of database: 114,650 effective HSP length: 64 effective length of query: 954 effective length of database: 94,362 effective search space: 90021348 effective search space used: 90021348 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -