BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000237-TA|BGIBMGA000237-PA|undefined (1018 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 25 2.4 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 23 9.5 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 25.4 bits (53), Expect = 2.4 Identities = 10/21 (47%), Positives = 15/21 (71%) Query: 774 THRELSPKTFVRVQKENTLIV 794 T+ EL+P TF+ V + NT +V Sbjct: 326 TNTELNPNTFILVAENNTTMV 346 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 23.4 bits (48), Expect = 9.5 Identities = 8/32 (25%), Positives = 20/32 (62%) Query: 263 LGLALLITMTDSSDMDLVRRCVEHSPQLQAMV 294 +G++ ++ T +++ +R+C E SP Q ++ Sbjct: 234 VGVSNFLSSTRTAETGTIRKCDESSPHDQVII 265 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.318 0.132 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 274,302 Number of Sequences: 429 Number of extensions: 11704 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 20 Number of HSP's gapped (non-prelim): 2 length of query: 1018 length of database: 140,377 effective HSP length: 65 effective length of query: 953 effective length of database: 112,492 effective search space: 107204876 effective search space used: 107204876 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -