BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000234-TA|BGIBMGA000234-PA|IPR002891|Adenylylsulfate kinase, IPR002650|ATP-sulfurylase (475 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 26 0.79 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 4.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 4.2 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 23 4.2 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 9.7 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 9.7 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 9.7 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 25.8 bits (54), Expect = 0.79 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 6/67 (8%) Query: 300 TVGRSIVESTMDVIRLLESQGIIPSLES----NRSGVEELFIHGNRLTSAIEEAARLPQI 355 TVG + + RL S I S++ N S ++EL + GN LTS + +A R + Sbjct: 397 TVGAQLFNGLFVLNRLTLSGNAIASIDPLAFRNCSDLKELDLSGNELTS-VPDALRDLAL 455 Query: 356 ELTTLDL 362 L TLDL Sbjct: 456 -LKTLDL 461 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.4 bits (48), Expect = 4.2 Identities = 9/30 (30%), Positives = 19/30 (63%) Query: 303 RSIVESTMDVIRLLESQGIIPSLESNRSGV 332 R +V S++ +R+ + +G++P + SGV Sbjct: 217 RQVVVSSVANVRIADHRGVMPPVILENSGV 246 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.4 bits (48), Expect = 4.2 Identities = 9/30 (30%), Positives = 19/30 (63%) Query: 303 RSIVESTMDVIRLLESQGIIPSLESNRSGV 332 R +V S++ +R+ + +G++P + SGV Sbjct: 217 RQVVVSSVANVRIADHRGVMPPVILENSGV 246 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 23.4 bits (48), Expect = 4.2 Identities = 9/32 (28%), Positives = 18/32 (56%) Query: 180 YGLDGDNIRTGLNKNLGFTKEDREENIRRVAE 211 Y ++G+NI N N+ K+ + + ++AE Sbjct: 156 YQMNGNNITNFKNSNIFQLKQHMRDTMNKIAE 187 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.2 bits (45), Expect = 9.7 Identities = 11/35 (31%), Positives = 18/35 (51%) Query: 145 VSKATTELGQRAVEKNRKVGKFINITNDIVVGIPA 179 V K T+LG+ E+ K I + N+ + +PA Sbjct: 323 VQKELTDLGKLGEEEKADWWKDIMLLNEKTLAVPA 357 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.2 bits (45), Expect = 9.7 Identities = 11/35 (31%), Positives = 18/35 (51%) Query: 145 VSKATTELGQRAVEKNRKVGKFINITNDIVVGIPA 179 V K T+LG+ E+ K I + N+ + +PA Sbjct: 323 VQKELTDLGKLGEEEKADWWKDIMLLNEKTLAVPA 357 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.2 bits (45), Expect = 9.7 Identities = 11/35 (31%), Positives = 18/35 (51%) Query: 145 VSKATTELGQRAVEKNRKVGKFINITNDIVVGIPA 179 V K T+LG+ E+ K I + N+ + +PA Sbjct: 323 VQKELTDLGKLGEEEKADWWKDIMLLNEKTLAVPA 357 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.133 0.383 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,396 Number of Sequences: 429 Number of extensions: 4538 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 7 length of query: 475 length of database: 140,377 effective HSP length: 60 effective length of query: 415 effective length of database: 114,637 effective search space: 47574355 effective search space used: 47574355 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -