BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000233-TA|BGIBMGA000233-PA|IPR009832|Protein of unknown function DUF1397 (155 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 1.9 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 21 4.3 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 20 9.9 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 20 9.9 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 20 9.9 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 1.9 Identities = 16/58 (27%), Positives = 23/58 (39%) Query: 90 EKQSDLQKCYNQTAGQNANFDLNSLSPDNLPTLSFDKAEENAPGSADVLFAKMATVAM 147 E L KCY G+ + D LSP + + S AE D + A + A+ Sbjct: 419 EDWKPLDKCYFCLDGKLPHDDQPPLSPQSDSSSSSRSAESPMSVQVDPMAASVVAAAL 476 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.4 bits (43), Expect = 4.3 Identities = 11/26 (42%), Positives = 15/26 (57%) Query: 130 NAPGSADVLFAKMATVAMGLLAVALV 155 N +A +L M TV +GLL AL+ Sbjct: 304 NLTATAQMLGLYMVTVILGLLFHALI 329 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 20.2 bits (40), Expect = 9.9 Identities = 7/18 (38%), Positives = 10/18 (55%) Query: 13 PNGMIDEVFKKYCLQKTN 30 P +++ F YC KTN Sbjct: 207 PRFTLEKFFTDYCNSKTN 224 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 20.2 bits (40), Expect = 9.9 Identities = 7/18 (38%), Positives = 10/18 (55%) Query: 13 PNGMIDEVFKKYCLQKTN 30 P +++ F YC KTN Sbjct: 207 PRFTLEKFFTDYCNSKTN 224 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 20.2 bits (40), Expect = 9.9 Identities = 9/29 (31%), Positives = 15/29 (51%) Query: 87 CFQEKQSDLQKCYNQTAGQNANFDLNSLS 115 CF + L CY + + +F L+SL+ Sbjct: 1057 CFDSDRERLYDCYVCYSPNDEDFVLHSLA 1085 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.133 0.385 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 41,748 Number of Sequences: 429 Number of extensions: 1629 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 155 length of database: 140,377 effective HSP length: 53 effective length of query: 102 effective length of database: 117,640 effective search space: 11999280 effective search space used: 11999280 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.3 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -