BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000230-TA|BGIBMGA000230-PA|IPR013535|PUL (294 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 28 0.086 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 26 0.46 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 4.3 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 22 5.6 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 28.3 bits (60), Expect = 0.086 Identities = 12/33 (36%), Positives = 21/33 (63%) Query: 59 SYIRFDQANIKAIYDKLREFNSKVGDGHNPLSD 91 S+I AN +++ +K+R+ N K D HN +S+ Sbjct: 152 SFIDLFNANARSVVEKMRKENGKEFDCHNYMSE 184 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 25.8 bits (54), Expect = 0.46 Identities = 10/23 (43%), Positives = 14/23 (60%) Query: 12 GESRYVPGSGTAVPGLPPPSSRD 34 G +R +P SG+ P PPP + D Sbjct: 1846 GSARNIPVSGSPEPPPPPPRNHD 1868 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.6 bits (46), Expect = 4.3 Identities = 7/14 (50%), Positives = 10/14 (71%) Query: 16 YVPGSGTAVPGLPP 29 Y+PG+G +P PP Sbjct: 419 YLPGNGVIIPDDPP 432 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 22.2 bits (45), Expect = 5.6 Identities = 8/17 (47%), Positives = 12/17 (70%) Query: 80 SKVGDGHNPLSDEQLQN 96 +KVG G PL +E+ +N Sbjct: 332 TKVGSGEIPLEEEEWEN 348 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.318 0.134 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,205 Number of Sequences: 429 Number of extensions: 3181 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 4 length of query: 294 length of database: 140,377 effective HSP length: 57 effective length of query: 237 effective length of database: 115,924 effective search space: 27473988 effective search space used: 27473988 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -