BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000229-TA|BGIBMGA000229-PA|IPR001680|WD-40 repeat, IPR011046|WD40-like (337 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 23 3.2 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 23 4.2 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 23 4.2 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 22 5.5 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 23.0 bits (47), Expect = 3.2 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 184 RVFTKDPAR-FADEETIKNFEEEVEKIQASSEQEI 217 RV K A F DE+ +N ++ KI + ++QEI Sbjct: 502 RVGNKGKATSFFDEDQDRNLASDLAKILSQAKQEI 536 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 22.6 bits (46), Expect = 4.2 Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 45 EGVKEFVNVITYKGHRNFVSCICW 68 EG++E V+ ++GH IC+ Sbjct: 286 EGIREEVDTFMFEGHDTTSVSICY 309 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 22.6 bits (46), Expect = 4.2 Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 45 EGVKEFVNVITYKGHRNFVSCICW 68 EG++E V+ ++GH IC+ Sbjct: 286 EGIREEVDTFMFEGHDTTSVSICY 309 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 22.2 bits (45), Expect = 5.5 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Query: 228 PEVLLEPGKSDGQTKLVRRGAAVKCYS---WSVAENTWNE 264 PE+ ++ + T L+ G+ V C S WS T N+ Sbjct: 88 PEIKIQISQQQSVTALLDTGSEVSCISEEVWSKLIETGNK 127 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.134 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,639 Number of Sequences: 317 Number of extensions: 3561 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 4 length of query: 337 length of database: 114,650 effective HSP length: 57 effective length of query: 280 effective length of database: 96,581 effective search space: 27042680 effective search space used: 27042680 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -