BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000227-TA|BGIBMGA000227-PA|undefined (68 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 0.28 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 19 6.1 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 18 8.0 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 23.0 bits (47), Expect = 0.28 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Query: 32 TTSMMNPYQDQETIRPIKLKASVR----IHKTGSQVDLRV 67 TT +MN ++Q RPI K R IHK S + +++ Sbjct: 173 TTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQL 212 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 18.6 bits (36), Expect = 6.1 Identities = 6/15 (40%), Positives = 11/15 (73%) Query: 33 TSMMNPYQDQETIRP 47 + ++N YQ+ +IRP Sbjct: 88 SKILNRYQETGSIRP 102 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 18.2 bits (35), Expect = 8.0 Identities = 9/25 (36%), Positives = 13/25 (52%) Query: 35 MMNPYQDQETIRPIKLKASVRIHKT 59 ++N QE K+K V +HKT Sbjct: 63 LINLIIKQEEFFSPKIKRMVLLHKT 87 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.315 0.129 0.365 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,620 Number of Sequences: 317 Number of extensions: 254 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 68 length of database: 114,650 effective HSP length: 44 effective length of query: 24 effective length of database: 100,702 effective search space: 2416848 effective search space used: 2416848 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 35 (18.9 bits) S2: 35 (18.2 bits)
- SilkBase 1999-2023 -