SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000227-TA|BGIBMGA000227-PA|undefined
         (68 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_6098| Best HMM Match : Gal-3-0_sulfotr (HMM E-Value=1e-39)          25   8.5  

>SB_6098| Best HMM Match : Gal-3-0_sulfotr (HMM E-Value=1e-39)
          Length = 463

 Score = 25.0 bits (52), Expect = 8.5
 Identities = 12/38 (31%), Positives = 20/38 (52%)

Query: 31 ATTSMMNPYQDQETIRPIKLKASVRIHKTGSQVDLRVF 68
          +T+S  N   D+E+  P +    ++ HKTGS     +F
Sbjct: 53 STSSSDNQKMDEESCVPEQSIVFLKTHKTGSSTLTNIF 90


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.315    0.129    0.365 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,713,055
Number of Sequences: 59808
Number of extensions: 35583
Number of successful extensions: 49
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 48
Number of HSP's gapped (non-prelim): 1
length of query: 68
length of database: 16,821,457
effective HSP length: 47
effective length of query: 21
effective length of database: 14,010,481
effective search space: 294220101
effective search space used: 294220101
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 52 (25.0 bits)

- SilkBase 1999-2023 -