BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000227-TA|BGIBMGA000227-PA|undefined (68 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 25 0.93 SPCC965.10 |||transcription factor |Schizosaccharomyces pombe|ch... 24 2.2 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 25.4 bits (53), Expect = 0.93 Identities = 10/27 (37%), Positives = 16/27 (59%) Query: 32 TTSMMNPYQDQETIRPIKLKASVRIHK 58 TTS NP +D+E P+ A V+ ++ Sbjct: 212 TTSWNNPLEDEEQTSPLDYTAKVQFNR 238 >SPCC965.10 |||transcription factor |Schizosaccharomyces pombe|chr 3|||Manual Length = 525 Score = 24.2 bits (50), Expect = 2.2 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 11 KSTAVDYEETEKXXXXXXXXATTSMMNPYQDQETIRPIKLKASVRIHKTGSQVDL 65 KS +D E++E TT M Q + P+ L+ V +HK +DL Sbjct: 388 KSNKLDSEKSEPLQLFKLYKTTTEMYLR-QVISRMPPVSLEMQVLLHKQTQLIDL 441 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.315 0.129 0.365 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 242,012 Number of Sequences: 5004 Number of extensions: 5482 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 2 length of query: 68 length of database: 2,362,478 effective HSP length: 48 effective length of query: 20 effective length of database: 2,122,286 effective search space: 42445720 effective search space used: 42445720 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -