GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000227-TA|BGIBMGA000227-PA|undefined
         (68 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p...    21   5.8  

>AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein
            protein.
          Length = 3325

 Score = 20.6 bits (41), Expect = 5.8
 Identities = 11/51 (21%), Positives = 18/51 (35%)

Query: 10   PKSTAVDYEETEKXXXXXXXXATTSMMNPYQDQETIRPIKLKASVRIHKTG 60
            P S  +DY++            +  +     D ETIR  +    V +   G
Sbjct: 2494 PCSPGLDYDDESHAKYVSDIGRSKMLNESVDDSETIREYRRPRDVLLSVVG 2544


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.315    0.129    0.365 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 53,418
Number of Sequences: 2123
Number of extensions: 1354
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 68
length of database: 516,269
effective HSP length: 46
effective length of query: 22
effective length of database: 418,611
effective search space:  9209442
effective search space used:  9209442
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.1 bits)
S2: 40 (20.2 bits)