BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000227-TA|BGIBMGA000227-PA|undefined (68 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 21 5.8 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 20.6 bits (41), Expect = 5.8 Identities = 11/51 (21%), Positives = 18/51 (35%) Query: 10 PKSTAVDYEETEKXXXXXXXXATTSMMNPYQDQETIRPIKLKASVRIHKTG 60 P S +DY++ + + D ETIR + V + G Sbjct: 2494 PCSPGLDYDDESHAKYVSDIGRSKMLNESVDDSETIREYRRPRDVLLSVVG 2544 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.315 0.129 0.365 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 53,418 Number of Sequences: 2123 Number of extensions: 1354 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of query: 68 length of database: 516,269 effective HSP length: 46 effective length of query: 22 effective length of database: 418,611 effective search space: 9209442 effective search space used: 9209442 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.1 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -