BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000226-TA|BGIBMGA000226-PA|IPR000618|Insect cuticle protein (398 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 3.8 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 6.7 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 22 8.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 3.8 Identities = 9/28 (32%), Positives = 14/28 (50%) Query: 52 GSSYHLAHGTANGVVGGRFGGKDPATDT 79 G S+ LA NG+ +GG + +T Sbjct: 2069 GQSFSLADNNQNGLNAATYGGGEAGEET 2096 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.2 bits (45), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Query: 367 PAFSQSGNEDLGYVDE 382 P S SG +DLG DE Sbjct: 2 PHVSSSGGDDLGSTDE 17 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 21.8 bits (44), Expect = 8.9 Identities = 13/45 (28%), Positives = 18/45 (40%) Query: 123 PNEDPSYAFNFDTRTYSKNENADSRGDVKGHYSYVDDIGERHDVS 167 PN +P+ + T + GD G S VDD E + S Sbjct: 60 PNLNPAVQGSSLTEGKRSKRSKRPNGDTNGDTSQVDDQNESLEAS 104 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.136 0.413 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,920 Number of Sequences: 317 Number of extensions: 5160 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 3 length of query: 398 length of database: 114,650 effective HSP length: 58 effective length of query: 340 effective length of database: 96,264 effective search space: 32729760 effective search space used: 32729760 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -