BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000225-TA|BGIBMGA000225-PA|undefined (124 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.84 SB_32809| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.5 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 29.5 bits (63), Expect = 0.84 Identities = 28/102 (27%), Positives = 42/102 (41%), Gaps = 4/102 (3%) Query: 19 EEHTMPAERKRNKREVPFTHDEKRIAGCLLQCVYRKVKAVDGFGFPTLEGLVGLYSDGVN 78 ++HT P+ RKR KR+ + KR L + V R DGF LE + Sbjct: 252 QQHTAPSPRKRLKRQTHVAVN-KRPEPKLTESVPRNRTEEDGFRMSALEEM--WERKLAQ 308 Query: 79 ERGYFMAVLEASRECLMKNHDKFSRTTPMGNTTAMQSDLNNN 120 +R F ++E RE L + + G T + + NN Sbjct: 309 DREQFEKLMEFQRESLQVQQQQ-TNAIISGLTNILNTLAKNN 349 >SB_32809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 312 Score = 27.1 bits (57), Expect = 4.5 Identities = 13/22 (59%), Positives = 15/22 (68%) Query: 51 VYRKVKAVDGFGFPTLEGLVGL 72 V R+VK V GFGF +GL GL Sbjct: 134 VTRRVKPVHGFGFVFRQGLGGL 155 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.322 0.137 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,196,331 Number of Sequences: 59808 Number of extensions: 150852 Number of successful extensions: 292 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 291 Number of HSP's gapped (non-prelim): 2 length of query: 124 length of database: 16,821,457 effective HSP length: 74 effective length of query: 50 effective length of database: 12,395,665 effective search space: 619783250 effective search space used: 619783250 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -