BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000225-TA|BGIBMGA000225-PA|undefined (124 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 25 0.19 AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding prote... 23 1.3 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 22 1.8 AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding prote... 22 1.8 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 2.3 AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding prote... 21 5.4 AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-bind... 21 5.4 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 20 9.4 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 25.4 bits (53), Expect = 0.19 Identities = 15/68 (22%), Positives = 34/68 (50%), Gaps = 5/68 (7%) Query: 21 HTMPAERKRNKREVPFTHDEK--RIAGCLLQCVYRKVKAVDGFGFPT--LEGLV-GLYSD 75 H + R ++ + ++E+ R GC L C++++ ++G T + G++ G Y D Sbjct: 43 HELKKLRDSSEARIKLINEEENFRNYGCFLACIWQQTGVMNGSELSTYNIAGIIEGQYHD 102 Query: 76 GVNERGYF 83 + + +F Sbjct: 103 DEDLKTFF 110 >AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 22.6 bits (46), Expect = 1.3 Identities = 7/24 (29%), Positives = 15/24 (62%) Query: 37 THDEKRIAGCLLQCVYRKVKAVDG 60 + ++ + GC CV++K+ +DG Sbjct: 45 SEEQMKKLGCFEACVFQKLHFMDG 68 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.2 bits (45), Expect = 1.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Query: 58 VDGFGFPTLEGLVGLYSDGVNERGY 82 ++GF F +GL GL + GY Sbjct: 228 INGFNFQWKDGLFGLSLSALQTDGY 252 >AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 22.2 bits (45), Expect = 1.8 Identities = 7/24 (29%), Positives = 15/24 (62%) Query: 37 THDEKRIAGCLLQCVYRKVKAVDG 60 + ++ + GC CV++K+ +DG Sbjct: 45 SEEQMKKFGCFEACVFQKLHFMDG 68 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.8 bits (44), Expect = 2.3 Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 25 AERKRNKREVPFTHDE 40 A+ +RN+R P HDE Sbjct: 174 AQIRRNERRTPDPHDE 189 >AF393493-1|AAL60418.1| 142|Apis mellifera odorant binding protein ASP2 protein. Length = 142 Score = 20.6 bits (41), Expect = 5.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Query: 45 GCLLQCVYRKVKAVDG 60 GCL CV ++++ + G Sbjct: 67 GCLKACVMKRIEMLKG 82 >AF166497-1|AAD51945.1| 142|Apis mellifera putative odorant-binding protein ASP2 protein. Length = 142 Score = 20.6 bits (41), Expect = 5.4 Identities = 6/16 (37%), Positives = 11/16 (68%) Query: 45 GCLLQCVYRKVKAVDG 60 GCL CV ++++ + G Sbjct: 67 GCLKACVMKRIEMLKG 82 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 19.8 bits (39), Expect = 9.4 Identities = 9/29 (31%), Positives = 14/29 (48%) Query: 92 ECLMKNHDKFSRTTPMGNTTAMQSDLNNN 120 E +N + + T NT A ++ NNN Sbjct: 217 ETCQRNSNNSTITAGNANTNASNNNNNNN 245 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.322 0.137 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,326 Number of Sequences: 429 Number of extensions: 1433 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 124 length of database: 140,377 effective HSP length: 51 effective length of query: 73 effective length of database: 118,498 effective search space: 8650354 effective search space used: 8650354 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (21.0 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -