BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000218-TA|BGIBMGA000218-PA|IPR003958|Transcription factor CBF/NF-Y/archaeal histone, IPR009072|Histone-fold (145 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 21 3.3 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 21 5.8 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 21.4 bits (43), Expect = 3.3 Identities = 11/37 (29%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 89 DAVFLVTKATEMFLETIVKETYAFTSSNKR-KVISKK 124 +++FLV A + L +++ ++S NK + I KK Sbjct: 23 NSIFLVMSAVTIILSSLIFNQEQWSSLNKNFQFIDKK 59 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 20.6 bits (41), Expect = 5.8 Identities = 9/28 (32%), Positives = 16/28 (57%) Query: 3 EEECHEDVDISDITEHSESYLENEHLKF 30 ++E HE +D D + S EN++ +F Sbjct: 280 DKEEHESMDDDDDDDDDMSNSENQNPRF 307 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.128 0.342 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,835 Number of Sequences: 317 Number of extensions: 1000 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 145 length of database: 114,650 effective HSP length: 51 effective length of query: 94 effective length of database: 98,483 effective search space: 9257402 effective search space used: 9257402 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.0 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -