BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000216-TA|BGIBMGA000216-PA|undefined (166 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X06256-1|CAA29601.1| 1049|Homo sapiens protein ( Human mRNA for ... 29 7.8 M13918-1|AAA52467.1| 1034|Homo sapiens fibronectin receptor alph... 29 7.8 BC008786-1|AAH08786.1| 1049|Homo sapiens integrin, alpha 5 (fibr... 29 7.8 >X06256-1|CAA29601.1| 1049|Homo sapiens protein ( Human mRNA for integrin alpha 5 subunit. ). Length = 1049 Score = 29.1 bits (62), Expect = 7.8 Identities = 10/36 (27%), Positives = 21/36 (58%) Query: 77 QPRFPYESYTKFDLVEEFLCNCGVDNVCTCSMKTEL 112 +P Y+S ++ + + L +CG DN+C ++ E+ Sbjct: 624 RPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEV 659 >M13918-1|AAA52467.1| 1034|Homo sapiens fibronectin receptor alpha-subunit precursor protein. Length = 1034 Score = 29.1 bits (62), Expect = 7.8 Identities = 10/36 (27%), Positives = 21/36 (58%) Query: 77 QPRFPYESYTKFDLVEEFLCNCGVDNVCTCSMKTEL 112 +P Y+S ++ + + L +CG DN+C ++ E+ Sbjct: 609 RPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEV 644 >BC008786-1|AAH08786.1| 1049|Homo sapiens integrin, alpha 5 (fibronectin receptor, alpha polypeptide) protein. Length = 1049 Score = 29.1 bits (62), Expect = 7.8 Identities = 10/36 (27%), Positives = 21/36 (58%) Query: 77 QPRFPYESYTKFDLVEEFLCNCGVDNVCTCSMKTEL 112 +P Y+S ++ + + L +CG DN+C ++ E+ Sbjct: 624 RPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEV 659 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.320 0.133 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,548,821 Number of Sequences: 224733 Number of extensions: 973878 Number of successful extensions: 1661 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1658 Number of HSP's gapped (non-prelim): 3 length of query: 166 length of database: 73,234,838 effective HSP length: 85 effective length of query: 81 effective length of database: 54,132,533 effective search space: 4384735173 effective search space used: 4384735173 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 62 (29.1 bits)
- SilkBase 1999-2023 -