GeneModel BLAST Result against fruitfly

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000216-TA|BGIBMGA000216-PA|undefined
         (166 letters)

Database: fruitfly 
           52,641 sequences; 24,830,863 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY089353-1|AAL90091.1|  270|Drosophila melanogaster AT17695p pro...    29   2.4  

>AY089353-1|AAL90091.1|  270|Drosophila melanogaster AT17695p
           protein.
          Length = 270

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 3/49 (6%)

Query: 117 KCQGKIPKRIFKGLTLQSALCHLVPLQADSKINLKVIKKTSQLLTMKQM 165
           K   ++ KR  KGL   +   H  P QAD+K NL+ ++    L T + +
Sbjct: 223 KAAKRVQKRRCKGLKKTN---HFAPAQADAKDNLRTVRGNEGLSTQRSV 268


  Database: fruitfly
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 24,830,863
  Number of sequences in database:  52,641
  
Lambda     K      H
   0.320    0.133    0.408 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,175,159
Number of Sequences: 52641
Number of extensions: 332110
Number of successful extensions: 571
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 571
Number of HSP's gapped (non-prelim): 1
length of query: 166
length of database: 24,830,863
effective HSP length: 80
effective length of query: 86
effective length of database: 20,619,583
effective search space: 1773284138
effective search space used: 1773284138
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 58 (27.5 bits)