GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000215-TA|BGIBMGA000215-PA|IPR002159|CD36 antigen
         (483 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxida...    25   1.2  

>AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxidase
           subunit 2 protein.
          Length = 683

 Score = 25.0 bits (52), Expect = 1.2
 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 170 PNGIVFEPNNQLRFSLFGVRNNSVDPHVVTVKRGVQNVMDVGRVVAIDGKTKMN 223
           P G + E      FSLF  ++  +   ++ +  G++NV D+   VA+  + ++N
Sbjct: 67  PLGEILELERDANFSLFIPKHRRIAGRLIDIFLGMRNVDDL-LSVAVYARDRVN 119


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.321    0.139    0.421 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 114,696
Number of Sequences: 317
Number of extensions: 5021
Number of successful extensions: 7
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 6
Number of HSP's gapped (non-prelim): 1
length of query: 483
length of database: 114,650
effective HSP length: 59
effective length of query: 424
effective length of database: 95,947
effective search space: 40681528
effective search space used: 40681528
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 45 (22.2 bits)