BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000215-TA|BGIBMGA000215-PA|IPR002159|CD36 antigen
(483 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 25 1.2
>AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase
subunit 2 protein.
Length = 683
Score = 25.0 bits (52), Expect = 1.2
Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 1/54 (1%)
Query: 170 PNGIVFEPNNQLRFSLFGVRNNSVDPHVVTVKRGVQNVMDVGRVVAIDGKTKMN 223
P G + E FSLF ++ + ++ + G++NV D+ VA+ + ++N
Sbjct: 67 PLGEILELERDANFSLFIPKHRRIAGRLIDIFLGMRNVDDL-LSVAVYARDRVN 119
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.321 0.139 0.421
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 114,696
Number of Sequences: 317
Number of extensions: 5021
Number of successful extensions: 7
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 6
Number of HSP's gapped (non-prelim): 1
length of query: 483
length of database: 114,650
effective HSP length: 59
effective length of query: 424
effective length of database: 95,947
effective search space: 40681528
effective search space used: 40681528
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 45 (22.2 bits)
- SilkBase 1999-2023 -