BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000211-TA|BGIBMGA000211-PA|IPR001356|Homeobox, IPR009057|Homeodomain-like (124 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16450| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 4e-23 SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 4e-17 SB_16449| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 8e-17 SB_26245| Best HMM Match : Homeobox (HMM E-Value=1.7e-32) 79 8e-16 SB_39292| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 2e-14 SB_21452| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 2e-13 SB_54937| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 8e-13 SB_28488| Best HMM Match : PAX (HMM E-Value=0) 69 8e-13 SB_37079| Best HMM Match : Homeobox (HMM E-Value=1.2e-28) 69 1e-12 SB_21036| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 3e-12 SB_47477| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-12 SB_16319| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-12 SB_39161| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 5e-12 SB_52575| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-11 SB_44118| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-11 SB_47478| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-11 SB_16448| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 2e-11 SB_22965| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 4e-11 SB_51509| Best HMM Match : Homeobox (HMM E-Value=2.3e-09) 63 6e-11 SB_34509| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-10 SB_5296| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 4e-10 SB_54939| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 7e-10 SB_49289| Best HMM Match : Homeobox (HMM E-Value=6e-30) 58 2e-09 SB_10426| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 2e-09 SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 2e-08 SB_22062| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-06 SB_5629| Best HMM Match : PAX (HMM E-Value=0) 47 5e-06 SB_31530| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-06 SB_48629| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 7e-06 SB_48493| Best HMM Match : Homeobox (HMM E-Value=6.3e-08) 46 9e-06 SB_3037| Best HMM Match : Homeobox (HMM E-Value=4.3e-27) 46 1e-05 SB_57651| Best HMM Match : Homeobox (HMM E-Value=3e-29) 45 2e-05 SB_48630| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_41749| Best HMM Match : Homeobox (HMM E-Value=4.1e-29) 45 2e-05 SB_57648| Best HMM Match : Homeobox (HMM E-Value=5.3e-30) 45 2e-05 SB_21212| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_11435| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-05 SB_20497| Best HMM Match : Homeobox (HMM E-Value=1.4013e-45) 44 5e-05 SB_49275| Best HMM Match : Homeobox (HMM E-Value=2.8e-27) 43 6e-05 SB_11048| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) 43 8e-05 SB_49340| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) 43 8e-05 SB_18861| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) 43 8e-05 SB_18749| Best HMM Match : Homeobox (HMM E-Value=6.1e-28) 43 8e-05 SB_17558| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) 43 8e-05 SB_49708| Best HMM Match : Homeobox (HMM E-Value=8.1e-30) 42 1e-04 SB_174| Best HMM Match : Homeobox (HMM E-Value=1.9e-19) 42 1e-04 SB_5495| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_596| Best HMM Match : Homeobox (HMM E-Value=4.5e-32) 42 2e-04 SB_36278| Best HMM Match : Homeobox (HMM E-Value=4.8e-30) 41 3e-04 SB_17425| Best HMM Match : Homeobox (HMM E-Value=7.2e-07) 41 3e-04 SB_6972| Best HMM Match : Homeobox (HMM E-Value=7.2e-07) 41 3e-04 SB_6712| Best HMM Match : Homeobox (HMM E-Value=8e-06) 41 3e-04 SB_51696| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 4e-04 SB_36166| Best HMM Match : Homeobox (HMM E-Value=2.6e-28) 40 4e-04 SB_42150| Best HMM Match : Homeobox (HMM E-Value=1.8e-29) 40 6e-04 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 40 6e-04 SB_24287| Best HMM Match : Homeobox (HMM E-Value=9e-28) 40 6e-04 SB_41873| Best HMM Match : Homeobox (HMM E-Value=2.3e-29) 40 8e-04 SB_26105| Best HMM Match : Homeobox (HMM E-Value=1.1e-30) 39 0.001 SB_11047| Best HMM Match : Homeobox (HMM E-Value=5.3e-17) 39 0.001 SB_8061| Best HMM Match : Homeobox (HMM E-Value=5.1e-27) 39 0.001 SB_29192| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.001 SB_15284| Best HMM Match : Homeobox (HMM E-Value=5.3e-17) 39 0.001 SB_22870| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.001 SB_15| Best HMM Match : Homeobox (HMM E-Value=4.1e-30) 38 0.002 SB_25357| Best HMM Match : Homeobox (HMM E-Value=8.3e-28) 38 0.002 SB_14839| Best HMM Match : Homeobox (HMM E-Value=4.3e-13) 38 0.002 SB_53176| Best HMM Match : Homeobox (HMM E-Value=0) 38 0.003 SB_10406| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.004 SB_10405| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.006 SB_39723| Best HMM Match : Homeobox (HMM E-Value=5.4e-32) 36 0.007 SB_10407| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.007 SB_34953| Best HMM Match : Homeobox (HMM E-Value=1e-25) 36 0.010 SB_21878| Best HMM Match : Homeobox (HMM E-Value=1.5e-25) 36 0.010 SB_10703| Best HMM Match : Homeobox (HMM E-Value=4.6e-08) 36 0.010 SB_8774| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_7899| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_55403| Best HMM Match : Homeobox (HMM E-Value=8e-07) 36 0.013 SB_45591| Best HMM Match : Homeobox (HMM E-Value=7.3e-18) 36 0.013 SB_8063| Best HMM Match : Homeobox (HMM E-Value=8.5e-24) 36 0.013 SB_30811| Best HMM Match : Homeobox (HMM E-Value=2.5e-26) 35 0.017 SB_29536| Best HMM Match : Homeobox (HMM E-Value=2.6e-30) 35 0.017 SB_22129| Best HMM Match : Homeobox (HMM E-Value=4.6e-26) 35 0.017 SB_53178| Best HMM Match : Homeobox (HMM E-Value=2.5e-26) 35 0.017 SB_41100| Best HMM Match : Homeobox (HMM E-Value=1.5e-24) 35 0.017 SB_11160| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.017 SB_45690| Best HMM Match : Homeobox (HMM E-Value=4.6e-31) 35 0.022 SB_16156| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.022 SB_32587| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.022 SB_47662| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.039 SB_23338| Best HMM Match : Homeobox (HMM E-Value=3.1e-26) 33 0.051 SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) 33 0.068 SB_45417| Best HMM Match : Homeobox (HMM E-Value=5.1e-09) 33 0.090 SB_2217| Best HMM Match : LIM (HMM E-Value=1.2e-40) 33 0.090 SB_8775| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.12 SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.16 SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) 32 0.16 SB_1883| Best HMM Match : LIM (HMM E-Value=2.20004e-42) 32 0.16 SB_40083| Best HMM Match : Homeobox (HMM E-Value=0.00011) 31 0.21 SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) 31 0.27 SB_58034| Best HMM Match : VWA (HMM E-Value=0) 31 0.36 SB_40906| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.48 SB_25008| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.63 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 29 1.1 SB_18528| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 29 1.5 SB_20327| Best HMM Match : LIM (HMM E-Value=4.9e-16) 28 1.9 SB_58730| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_47596| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 >SB_16450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 286 Score = 103 bits (247), Expect = 4e-23 Identities = 47/52 (90%), Positives = 52/52 (100%) Query: 55 GRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 G+PRKVRRSRTTFTTYQLH+LERAF+KTQYPDVFTREELA+RL+LSEARVQV Sbjct: 87 GKPRKVRRSRTTFTTYQLHQLERAFEKTQYPDVFTREELALRLDLSEARVQV 138 >SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 83.8 bits (198), Expect = 4e-17 Identities = 40/59 (67%), Positives = 48/59 (81%) Query: 48 QLEAIDAGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 +LE D+ RK RR RTTFT+YQL ELERAF KT YPDVFTRE LA++++L+EARVQV Sbjct: 274 ELEGKDSTAKRKQRRYRTTFTSYQLEELERAFAKTHYPDVFTREALAVKIDLTEARVQV 332 >SB_16449| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 82.6 bits (195), Expect = 8e-17 Identities = 37/57 (64%), Positives = 47/57 (82%) Query: 50 EAIDAGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 EA +K+RR+RTTFTT+QLHELERAF+K+ YPDV+TREELA+++ L E RVQV Sbjct: 75 EADGDSSKKKLRRNRTTFTTFQLHELERAFEKSHYPDVYTREELALKISLPEVRVQV 131 >SB_26245| Best HMM Match : Homeobox (HMM E-Value=1.7e-32) Length = 1168 Score = 79.4 bits (187), Expect = 8e-16 Identities = 36/54 (66%), Positives = 43/54 (79%) Query: 53 DAGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 D+ RK RR+RTTFT YQL E+ER F KT YPDV+TRE+LA+R L+EARVQV Sbjct: 397 DSAPKRKKRRNRTTFTAYQLEEMERVFQKTHYPDVYTREQLALRCALTEARVQV 450 >SB_39292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 74.5 bits (175), Expect = 2e-14 Identities = 36/48 (75%), Positives = 41/48 (85%) Query: 58 RKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 RK RRSRT FT+ Q+ ELE+AF KTQYPDV+TREELA RL L+EARVQ Sbjct: 19 RKQRRSRTKFTSKQVDELEKAFLKTQYPDVYTREELAQRLNLTEARVQ 66 Score = 70.9 bits (166), Expect = 3e-13 Identities = 35/48 (72%), Positives = 37/48 (77%) Query: 59 KVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 K RRSRT FT Q ELERAF KT YPD++ REELA RL LSEARVQV Sbjct: 547 KPRRSRTRFTVSQTDELERAFRKTHYPDIYAREELAQRLGLSEARVQV 594 >SB_21452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 275 Score = 71.7 bits (168), Expect = 2e-13 Identities = 33/49 (67%), Positives = 39/49 (79%) Query: 58 RKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 +K R RTTF+ YQ+ ELERAFDK YPDVF REELA +L L+EAR+QV Sbjct: 61 KKKTRYRTTFSQYQIEELERAFDKAPYPDVFAREELAAKLGLTEARIQV 109 >SB_54937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 69.3 bits (162), Expect = 8e-13 Identities = 32/50 (64%), Positives = 41/50 (82%) Query: 58 RKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQVG 107 RK+RR+RTTFT QL LE+ F+K+ YPDV TREELA ++++SEARVQ G Sbjct: 107 RKLRRNRTTFTPDQLEMLEKEFEKSHYPDVATREELANKIDMSEARVQKG 156 >SB_28488| Best HMM Match : PAX (HMM E-Value=0) Length = 551 Score = 69.3 bits (162), Expect = 8e-13 Identities = 34/47 (72%), Positives = 36/47 (76%) Query: 59 KVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 K RRSRT FT Q ELERAF KT YPD++ REELA RL LSEARVQ Sbjct: 505 KPRRSRTRFTVSQTDELERAFRKTHYPDIYAREELAQRLGLSEARVQ 551 >SB_37079| Best HMM Match : Homeobox (HMM E-Value=1.2e-28) Length = 246 Score = 68.9 bits (161), Expect = 1e-12 Identities = 32/52 (61%), Positives = 39/52 (75%) Query: 55 GRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 G PRK RR RTTFT QL LE F KT+YPD+F REE+A+++ L E+RVQV Sbjct: 53 GPPRKQRRERTTFTKNQLEILEELFAKTRYPDIFMREEVAIKINLPESRVQV 104 >SB_21036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 67.7 bits (158), Expect = 3e-12 Identities = 30/49 (61%), Positives = 38/49 (77%) Query: 58 RKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 RK RR+RTTFT QL ELE+ F+K YPD+ REELA ++ +SEAR+QV Sbjct: 66 RKQRRNRTTFTKQQLQELEKVFEKKHYPDIALREELAAKINISEARIQV 114 >SB_47477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 632 Score = 67.3 bits (157), Expect = 3e-12 Identities = 31/51 (60%), Positives = 38/51 (74%) Query: 55 GRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 G PRK RR RTTFT QL LE F KT+YPD+F REE+A+++ L E+RVQ Sbjct: 434 GYPRKQRRERTTFTKNQLEILEELFAKTRYPDIFMREEVAIKINLPESRVQ 484 >SB_16319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 67.3 bits (157), Expect = 3e-12 Identities = 31/46 (67%), Positives = 37/46 (80%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 RR RTTF+ QL LE AF ++QYPDVFTRE+LA R+ L+EARVQV Sbjct: 159 RRHRTTFSKLQLDSLEEAFSRSQYPDVFTREQLAKRINLNEARVQV 204 >SB_39161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2103 Score = 66.9 bits (156), Expect = 5e-12 Identities = 32/57 (56%), Positives = 42/57 (73%) Query: 50 EAIDAGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 EAI+ K RRSRT F ++QL ELE+ + QYPDVFTRE LA++L+L E+R+QV Sbjct: 310 EAIEIPLLPKRRRSRTNFDSWQLEELEKIYHHNQYPDVFTREALALKLDLLESRIQV 366 >SB_52575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1267 Score = 65.3 bits (152), Expect = 1e-11 Identities = 29/49 (59%), Positives = 37/49 (75%) Query: 58 RKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 RK+RR+RTTF +QL LERAF +T YPDV RE+LA+ L E+R+QV Sbjct: 1106 RKIRRTRTTFNQFQLDTLERAFSRTHYPDVLLREQLAVYTNLPESRIQV 1154 Score = 57.6 bits (133), Expect = 3e-09 Identities = 26/51 (50%), Positives = 37/51 (72%) Query: 56 RPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 + RK RR RT FT++QL +LE F + +YPD+ REE+A+ L+EARV+V Sbjct: 737 KKRKQRRQRTHFTSFQLQQLEGTFGRNRYPDMQMREEIALYTNLTEARVRV 787 >SB_44118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 611 Score = 64.9 bits (151), Expect = 2e-11 Identities = 29/50 (58%), Positives = 37/50 (74%) Query: 56 RPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 R + RR RT FT Q+ +LE+ F+KT YPDVFTRE LA ++ LSEAR+Q Sbjct: 324 RSKMSRRQRTNFTDEQIEKLEKVFEKTHYPDVFTREGLAQQVNLSEARIQ 373 >SB_47478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 64.9 bits (151), Expect = 2e-11 Identities = 30/49 (61%), Positives = 37/49 (75%) Query: 58 RKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 RK RR RTTFT QL LE F KT+YPD+F REE+A+++ L E+RVQV Sbjct: 41 RKQRRERTTFTKNQLEVLEELFAKTRYPDIFMREEVAIKINLPESRVQV 89 >SB_16448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 64.9 bits (151), Expect = 2e-11 Identities = 31/48 (64%), Positives = 37/48 (77%) Query: 59 KVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 K +R RT FT QL+ELER F +T YPDVF REELA R+ L+E+RVQV Sbjct: 89 KQKRHRTRFTPAQLNELERCFARTHYPDVFMREELAARIGLTESRVQV 136 >SB_22965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 63.7 bits (148), Expect = 4e-11 Identities = 26/53 (49%), Positives = 39/53 (73%) Query: 54 AGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 + + K RR RT FT YQL ELE+AF ++ YPDV+ RE L+++++L E R+Q+ Sbjct: 90 SSKKAKKRRHRTIFTNYQLEELEKAFKESHYPDVYARENLSLKIDLPEDRIQI 142 >SB_51509| Best HMM Match : Homeobox (HMM E-Value=2.3e-09) Length = 53 Score = 63.3 bits (147), Expect = 6e-11 Identities = 28/47 (59%), Positives = 37/47 (78%) Query: 59 KVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 K RRSRT F ++QL ELE+ + QYPDVFTRE LA++L+L E+R+Q Sbjct: 7 KRRRSRTNFDSWQLEELEKIYHHNQYPDVFTREALALKLDLLESRIQ 53 >SB_34509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 62.5 bits (145), Expect = 1e-10 Identities = 29/51 (56%), Positives = 36/51 (70%) Query: 56 RPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 +P++ RR RT FT QL LE F KT YPDV REELAM+++L E RV+V Sbjct: 70 QPKRKRRHRTIFTEEQLELLETTFQKTHYPDVLLREELAMKVDLKEERVEV 120 >SB_5296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 60.5 bits (140), Expect = 4e-10 Identities = 28/46 (60%), Positives = 35/46 (76%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 RR+RT FT YQL +LE A+ K +YPDV RE LA RL ++E+RVQV Sbjct: 221 RRNRTKFTAYQLEQLEDAYQKAKYPDVQARETLAQRLGVAESRVQV 266 >SB_54939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 341 Score = 59.7 bits (138), Expect = 7e-10 Identities = 30/58 (51%), Positives = 35/58 (60%) Query: 49 LEAIDAGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 +E D +K RR RT FT YQL LE F T YPDV RE+LA + L EAR+QV Sbjct: 138 IETRDGKVKKKPRRMRTCFTPYQLQVLENTFCNTHYPDVMLREQLASYVNLPEARIQV 195 >SB_49289| Best HMM Match : Homeobox (HMM E-Value=6e-30) Length = 285 Score = 58.4 bits (135), Expect = 2e-09 Identities = 28/48 (58%), Positives = 34/48 (70%) Query: 59 KVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 K R+R FT QL +LER F++T YPD TRE LA +L LSEARVQ+ Sbjct: 115 KAPRNRKNFTGDQLRDLERLFEQTHYPDAMTREGLAKKLGLSEARVQI 162 >SB_10426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 58.0 bits (134), Expect = 2e-09 Identities = 31/58 (53%), Positives = 35/58 (60%) Query: 49 LEAIDAGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 LEA R RR+RT FT QL LE+ F KT YPDV RE+LA L EAR+QV Sbjct: 56 LEARKEKSRRGSRRTRTAFTHQQLTALEKVFSKTHYPDVEVREQLATSTNLQEARIQV 113 >SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 54.8 bits (126), Expect = 2e-08 Identities = 26/48 (54%), Positives = 32/48 (66%) Query: 59 KVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 K RR+RT FT QL LE F KT YPDV RE+LA + + E+R+QV Sbjct: 55 KHRRTRTAFTHQQLQILESTFSKTHYPDVVMREQLAAYINIPESRIQV 102 >SB_22062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 275 Score = 48.0 bits (109), Expect = 2e-06 Identities = 26/53 (49%), Positives = 34/53 (64%) Query: 54 AGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 A R +VRR RT FT +QL LE +FDK Y R++LA L+LSE +V+V Sbjct: 126 AARSSRVRRVRTAFTPFQLLCLETSFDKNHYVVGTERKQLASYLKLSETQVKV 178 >SB_5629| Best HMM Match : PAX (HMM E-Value=0) Length = 383 Score = 46.8 bits (106), Expect = 5e-06 Identities = 23/46 (50%), Positives = 31/46 (67%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 RR+RT FT+ QLH L+ F + YP + R+ELA L + E+RVQV Sbjct: 278 RRTRTRFTSQQLHVLQSEFTRNPYPTLEERKELARYLCVCESRVQV 323 >SB_31530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 661 Score = 46.8 bits (106), Expect = 5e-06 Identities = 22/46 (47%), Positives = 31/46 (67%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 RR+RTT+ +Q+ ELE AF YP ++ LA+RL L ++RVQV Sbjct: 416 RRNRTTYKRWQIEELESAFSINPYPTSLHKKALAVRLGLRDSRVQV 461 Score = 29.5 bits (63), Expect = 0.84 Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 74 ELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 +LE AF YP + LA+RL L ++RVQV Sbjct: 468 KLESAFAINPYPTCLYEKALAVRLGLRDSRVQV 500 Score = 29.5 bits (63), Expect = 0.84 Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 74 ELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 +LE AF YP + LA+RL L ++RVQV Sbjct: 507 KLESAFAINPYPTCLYEKALAVRLGLRDSRVQV 539 Score = 29.5 bits (63), Expect = 0.84 Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 74 ELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 +LE AF YP + LA+RL L ++RVQV Sbjct: 546 KLESAFAINPYPTCLYEKALAVRLGLRDSRVQV 578 >SB_48629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 46.4 bits (105), Expect = 7e-06 Identities = 22/48 (45%), Positives = 31/48 (64%) Query: 59 KVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 K R+ RT FTT+QL ELE F + Y R E+A+ L+L+E +V+V Sbjct: 144 KKRKERTAFTTHQLRELENEFTRNNYLTRLRRYEIAVSLDLTERQVKV 191 >SB_48493| Best HMM Match : Homeobox (HMM E-Value=6.3e-08) Length = 121 Score = 46.0 bits (104), Expect = 9e-06 Identities = 22/46 (47%), Positives = 30/46 (65%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 RR RT+F +QL LE AF +T YP ++ R++LA L E R+QV Sbjct: 24 RRVRTSFADWQLCALESAFAQTHYPPIYERDQLAGYTGLPEERIQV 69 >SB_3037| Best HMM Match : Homeobox (HMM E-Value=4.3e-27) Length = 308 Score = 45.6 bits (103), Expect = 1e-05 Identities = 20/52 (38%), Positives = 36/52 (69%) Query: 55 GRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 G+ +K+R+ RT ++++QL EL + F KTQY + R +LA L L++ +V++ Sbjct: 169 GKGKKIRKPRTIYSSFQLRELNKRFIKTQYLALPERADLAAYLGLTQTQVKI 220 >SB_57651| Best HMM Match : Homeobox (HMM E-Value=3e-29) Length = 294 Score = 45.2 bits (102), Expect = 2e-05 Identities = 23/48 (47%), Positives = 31/48 (64%) Query: 58 RKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 RK R+SRT FT QL LE+ F + +Y D R +LA L L+EA+V+ Sbjct: 166 RKCRKSRTVFTDLQLRVLEKTFSEQKYLDSTNRAKLAQILGLNEAQVK 213 >SB_48630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 45.2 bits (102), Expect = 2e-05 Identities = 21/54 (38%), Positives = 33/54 (61%) Query: 53 DAGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 D G+ + R+ RT F+ +QL ELE F + Y R E+A+ L+L+E +V+V Sbjct: 135 DGGKTTRKRKERTAFSKHQLQELENEFIRNNYLTRLRRYEIAVSLDLTERQVKV 188 >SB_41749| Best HMM Match : Homeobox (HMM E-Value=4.1e-29) Length = 269 Score = 45.2 bits (102), Expect = 2e-05 Identities = 21/46 (45%), Positives = 29/46 (63%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 +R R TF Q+ ++ER F YPDV R EL+ R LSE++VQ+ Sbjct: 75 KRYRATFDKAQIFQMERVFLLNHYPDVAARSELSRRTGLSESQVQI 120 >SB_57648| Best HMM Match : Homeobox (HMM E-Value=5.3e-30) Length = 205 Score = 44.8 bits (101), Expect = 2e-05 Identities = 21/48 (43%), Positives = 31/48 (64%) Query: 58 RKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 R+ R+SRT FT QL LE+ F + +Y D +R +LA L L+E +V+ Sbjct: 118 RRCRKSRTVFTDLQLRVLEKTFSEQKYLDTSSRSKLAQTLGLNETQVK 165 >SB_21212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 249 Score = 44.8 bits (101), Expect = 2e-05 Identities = 21/45 (46%), Positives = 30/45 (66%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 RR RTTFT QL +E F +YP + RE LA ++++SE+R+Q Sbjct: 78 RRKRTTFTHDQLQLMEAYFHNNRYPGIEQREGLAEKIQVSESRLQ 122 >SB_11435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 44.4 bits (100), Expect = 3e-05 Identities = 21/48 (43%), Positives = 31/48 (64%) Query: 58 RKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 R+ R+SRT FT QL LE+ F + +Y D +R +LA L L+E +V+ Sbjct: 508 RRCRKSRTVFTDLQLRVLEKTFSEQKYLDTSSRAKLAQTLGLNETQVK 555 >SB_20497| Best HMM Match : Homeobox (HMM E-Value=1.4013e-45) Length = 527 Score = 43.6 bits (98), Expect = 5e-05 Identities = 20/48 (41%), Positives = 30/48 (62%) Query: 59 KVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 K R+ RT FT +Q+ ELE F + Y R E+A+ L+L+E +V+V Sbjct: 91 KKRKERTAFTKHQIQELENEFQRNNYLTRLRRYEIAVSLDLTERQVKV 138 Score = 43.6 bits (98), Expect = 5e-05 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 48 QLEAIDAGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 ++E + + RK R+ RT F+ YQL ELER F + Y R E+A+ L+L E +V+ Sbjct: 339 EMERNEDAKSRK-RKERTVFSKYQLTELEREFCRNNYLTRLRRYEIAVSLDLGERQVK 395 >SB_49275| Best HMM Match : Homeobox (HMM E-Value=2.8e-27) Length = 116 Score = 43.2 bits (97), Expect = 6e-05 Identities = 21/46 (45%), Positives = 29/46 (63%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 +R RT F YQL LE+AF++ QY R +LA L L+E +V+V Sbjct: 51 KRCRTIFAPYQLQRLEKAFERQQYVAGEERRQLATGLNLTETQVKV 96 >SB_11048| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) Length = 193 Score = 42.7 bits (96), Expect = 8e-05 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Query: 57 PRKV-RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 PRK RR RT F+ Q LE AF ++P + RE+LA L++ E+R+QV Sbjct: 25 PRKSHRRQRTFFSKEQTVILEGAFQYERFPGIQIREKLARELDIDESRIQV 75 >SB_49340| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) Length = 193 Score = 42.7 bits (96), Expect = 8e-05 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Query: 57 PRKV-RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 PRK RR RT F+ Q LE AF ++P + RE+LA L++ E+R+QV Sbjct: 25 PRKSHRRQRTFFSKEQTVILEGAFQYERFPGIQIREKLARELDIDESRIQV 75 >SB_18861| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) Length = 193 Score = 42.7 bits (96), Expect = 8e-05 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Query: 57 PRKV-RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 PRK RR RT F+ Q LE AF ++P + RE+LA L++ E+R+QV Sbjct: 25 PRKSHRRQRTFFSKEQTVILEGAFQYERFPGIQIREKLARELDIDESRIQV 75 >SB_18749| Best HMM Match : Homeobox (HMM E-Value=6.1e-28) Length = 222 Score = 42.7 bits (96), Expect = 8e-05 Identities = 18/54 (33%), Positives = 35/54 (64%) Query: 53 DAGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 + G+ +K +++RTTFT Q+ ELE+ F+ +Y R ++A L ++E +V++ Sbjct: 102 EIGKCKKKKKARTTFTGRQIFELEKQFEAKKYLTATERSDMASLLNVTETQVKI 155 >SB_17558| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) Length = 193 Score = 42.7 bits (96), Expect = 8e-05 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Query: 57 PRKV-RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 PRK RR RT F+ Q LE AF ++P + RE+LA L++ E+R+QV Sbjct: 25 PRKSHRRQRTFFSKEQTVILEGAFQYERFPGIQIREKLARELDIDESRIQV 75 >SB_49708| Best HMM Match : Homeobox (HMM E-Value=8.1e-30) Length = 197 Score = 41.9 bits (94), Expect = 1e-04 Identities = 22/49 (44%), Positives = 30/49 (61%) Query: 58 RKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 R+ +R RT FT QL LE AF+K Y R++LA L LSE +++V Sbjct: 89 RRPKRIRTAFTPTQLLHLENAFEKNHYIVGTERKQLASYLNLSETQIKV 137 >SB_174| Best HMM Match : Homeobox (HMM E-Value=1.9e-19) Length = 149 Score = 41.9 bits (94), Expect = 1e-04 Identities = 20/46 (43%), Positives = 29/46 (63%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 RR RT F+ Q LE AF ++P + RE+LA L++ E+R+QV Sbjct: 3 RRQRTFFSKEQTVILEEAFQYERFPGIQIREKLARELDIDESRIQV 48 >SB_5495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 41.5 bits (93), Expect = 2e-04 Identities = 18/46 (39%), Positives = 28/46 (60%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 RR RT +T QL +E F++ ++P + RE L+ L + E R+QV Sbjct: 22 RRRRTFYTDSQLRRMEEVFERDRFPGIAARESLSEELGIKEDRLQV 67 >SB_596| Best HMM Match : Homeobox (HMM E-Value=4.5e-32) Length = 162 Score = 41.5 bits (93), Expect = 2e-04 Identities = 19/46 (41%), Positives = 29/46 (63%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 +R RT FT Q+ +LE F K++Y V R ELA L L+E ++++ Sbjct: 27 KRPRTAFTNEQIKDLEAEFQKSKYLSVSRRMELANSLSLTETQIKI 72 >SB_36278| Best HMM Match : Homeobox (HMM E-Value=4.8e-30) Length = 166 Score = 41.1 bits (92), Expect = 3e-04 Identities = 22/48 (45%), Positives = 29/48 (60%) Query: 59 KVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 K RR+RT FT QL LE F T+Y V R LA+ L L+E +V++ Sbjct: 47 KPRRARTAFTYEQLVALENKFKSTRYLSVCERLNLALSLGLTETQVKI 94 >SB_17425| Best HMM Match : Homeobox (HMM E-Value=7.2e-07) Length = 387 Score = 41.1 bits (92), Expect = 3e-04 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Query: 57 PRKV-RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 PRK RR RT F+ Q LE AF ++P + RE+LA L++ E+R+Q Sbjct: 25 PRKSHRRQRTFFSKEQTVILEGAFQYERFPGIQIREKLARELDIDESRIQ 74 >SB_6972| Best HMM Match : Homeobox (HMM E-Value=7.2e-07) Length = 74 Score = 41.1 bits (92), Expect = 3e-04 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Query: 57 PRKV-RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 PRK RR RT F+ Q LE AF ++P + RE+LA L++ E+R+Q Sbjct: 25 PRKSHRRQRTFFSKEQTVILEGAFQYERFPGIQIREKLARELDIDESRIQ 74 >SB_6712| Best HMM Match : Homeobox (HMM E-Value=8e-06) Length = 169 Score = 41.1 bits (92), Expect = 3e-04 Identities = 23/53 (43%), Positives = 29/53 (54%) Query: 56 RPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQVGA 108 R K RR RT F+T QL LE F K +PD R+ +A R L E R + G+ Sbjct: 102 RGDKRRRCRTVFSTEQLAILEEGFQKQHFPDNKLRQAIATRAGLPEDRDKFGS 154 >SB_51696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 40.3 bits (90), Expect = 4e-04 Identities = 18/54 (33%), Positives = 33/54 (61%) Query: 53 DAGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 D + R+ +++RT F+ Q+++LE FD +Y R LA +L L+E +V++ Sbjct: 206 DDSKKRRKKKTRTVFSRSQVYQLESTFDMKRYLSSSERAGLASQLHLTETQVKI 259 >SB_36166| Best HMM Match : Homeobox (HMM E-Value=2.6e-28) Length = 209 Score = 40.3 bits (90), Expect = 4e-04 Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Query: 48 QLEAIDAG-RPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARV 104 +LEAI A RK R+ RT FT Q+ ELER F +Y R+++AM L L A++ Sbjct: 110 KLEAIQARLSQRKRRKPRTCFTNRQIIELERRFMYQKYLSPSDRDDIAMALGLPGAQI 167 >SB_42150| Best HMM Match : Homeobox (HMM E-Value=1.8e-29) Length = 122 Score = 39.9 bits (89), Expect = 6e-04 Identities = 19/46 (41%), Positives = 28/46 (60%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 RR RT FT+ QL +LER F +Y + R +A L L+E +V++ Sbjct: 26 RRKRTAFTSKQLLQLEREFHNKKYVSLEERSVIATNLNLTEVQVKI 71 >SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) Length = 229 Score = 39.9 bits (89), Expect = 6e-04 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 3/58 (5%) Query: 53 DAGRPRKVRRSRTT---FTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQVG 107 D R + S TT FTTYQL++LE F + ++PDV T + +A+ LS ++ G Sbjct: 88 DESSTRHLAVSSTTPAHFTTYQLNKLEGIFSRQKWPDVVTLDVIALESNLSAEDIERG 145 >SB_24287| Best HMM Match : Homeobox (HMM E-Value=9e-28) Length = 561 Score = 39.9 bits (89), Expect = 6e-04 Identities = 20/47 (42%), Positives = 28/47 (59%) Query: 59 KVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 K RR RT FT+ QL LE F + +Y + R ELA + LS+ +V+ Sbjct: 432 KSRRKRTAFTSSQLKYLEEKFQEKKYLTISERNELAKSMYLSDTQVK 478 >SB_41873| Best HMM Match : Homeobox (HMM E-Value=2.3e-29) Length = 651 Score = 39.5 bits (88), Expect = 8e-04 Identities = 20/49 (40%), Positives = 32/49 (65%) Query: 58 RKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 +K +R+RT F+ QL +LE+ F Y R+++A L+LSEA+V+V Sbjct: 542 QKRKRARTAFSAEQLKKLEKRFQANHYIVGEERQKIAKDLDLSEAQVKV 590 >SB_26105| Best HMM Match : Homeobox (HMM E-Value=1.1e-30) Length = 315 Score = 39.1 bits (87), Expect = 0.001 Identities = 21/48 (43%), Positives = 28/48 (58%) Query: 59 KVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 K +R RT FT QL LE+ F++ QY R LA L L+E +V+V Sbjct: 247 KPKRIRTIFTPEQLERLEKEFERQQYMVGAERHYLAASLNLTETQVKV 294 >SB_11047| Best HMM Match : Homeobox (HMM E-Value=5.3e-17) Length = 193 Score = 39.1 bits (87), Expect = 0.001 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Query: 57 PRKV-RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 PRK RR T F+ Q LE AF ++P + RE+L L++ E+R+QV Sbjct: 25 PRKSHRRQNTFFSKEQTVILEGAFQYERFPGIQIREKLVRELDIDESRIQV 75 >SB_8061| Best HMM Match : Homeobox (HMM E-Value=5.1e-27) Length = 418 Score = 39.1 bits (87), Expect = 0.001 Identities = 19/54 (35%), Positives = 30/54 (55%) Query: 53 DAGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 + P K R+ R FT Q +ELER F + +Y RE+LA + L+ +V++ Sbjct: 85 EGNEPPKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREQLARIINLTPTQVKI 138 >SB_29192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 695 Score = 39.1 bits (87), Expect = 0.001 Identities = 19/52 (36%), Positives = 32/52 (61%) Query: 55 GRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 G + +R RT +T+ QL ELE+ F + +Y R ++A L+LSE +V++ Sbjct: 296 GGNSRSKRIRTAYTSMQLLELEKEFSQNRYLSRLRRIQIAALLDLSEKQVKI 347 >SB_15284| Best HMM Match : Homeobox (HMM E-Value=5.3e-17) Length = 159 Score = 39.1 bits (87), Expect = 0.001 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Query: 57 PRKV-RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 PRK RR T F+ Q LE AF ++P + RE+L L++ E+R+QV Sbjct: 25 PRKSHRRQNTFFSKEQTVILEGAFQYERFPGIQIREKLVRELDIDESRIQV 75 >SB_22870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 38.7 bits (86), Expect = 0.001 Identities = 21/51 (41%), Positives = 30/51 (58%) Query: 56 RPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 + K RR RTTFT+ Q +LE F + +Y R ELA L L+E +V++ Sbjct: 112 KENKPRRQRTTFTSEQTLKLELEFHQNEYITRSRRFELAACLNLTETQVKI 162 >SB_15| Best HMM Match : Homeobox (HMM E-Value=4.1e-30) Length = 287 Score = 38.3 bits (85), Expect = 0.002 Identities = 23/51 (45%), Positives = 28/51 (54%) Query: 56 RPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 R K +R RT F+ QL LER FD QY R LA L L+E +V+V Sbjct: 207 RAEKPKRVRTIFSPDQLDRLEREFDNQQYIVGTERFYLATELGLTETQVKV 257 >SB_25357| Best HMM Match : Homeobox (HMM E-Value=8.3e-28) Length = 317 Score = 38.3 bits (85), Expect = 0.002 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Query: 56 RPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 +PR+ +RSR F+ Q+ ELER F +Y R +LA L+L+E +V++ Sbjct: 127 KPRR-KRSRAAFSHQQVFELERRFSHQKYLSGPERADLAAALKLTETQVKI 176 >SB_14839| Best HMM Match : Homeobox (HMM E-Value=4.3e-13) Length = 319 Score = 37.9 bits (84), Expect = 0.002 Identities = 20/47 (42%), Positives = 25/47 (53%) Query: 60 VRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 + R RT F+ QL L+ F KTQ P V EEL L L A+ Q+ Sbjct: 143 IHRPRTRFSDLQLAALDMLFTKTQNPSVEVLEELCNTLHLELAQAQI 189 >SB_53176| Best HMM Match : Homeobox (HMM E-Value=0) Length = 373 Score = 37.5 bits (83), Expect = 0.003 Identities = 20/48 (41%), Positives = 26/48 (54%) Query: 59 KVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 + RR RT FT QL LE+ F + Y R ELA L LSE +++ Sbjct: 63 RTRRYRTAFTREQLKRLEKEFMRENYVSRTRRCELANALNLSETTIKI 110 Score = 37.5 bits (83), Expect = 0.003 Identities = 20/48 (41%), Positives = 26/48 (54%) Query: 59 KVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 + RR RT FT QL LE+ F + Y R ELA L LSE +++ Sbjct: 218 RTRRYRTAFTREQLKRLEKEFMRENYVSRTRRCELANALNLSETTIKI 265 >SB_10406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 37.1 bits (82), Expect = 0.004 Identities = 18/49 (36%), Positives = 31/49 (63%) Query: 58 RKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 R+ +R RT++T QL ELE+ F +Y R E++ L+L+E +V++ Sbjct: 168 RESKRHRTSYTNKQLLELEKEFHFNKYLCSSRRREISKALQLTERQVKI 216 >SB_10405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 36.7 bits (81), Expect = 0.006 Identities = 18/49 (36%), Positives = 30/49 (61%) Query: 58 RKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 R +R RT++T QL ELE+ F +Y R E++ L+L+E +V++ Sbjct: 78 RSSKRHRTSYTNKQLLELEKEFHFNKYLCSSRRREISKALQLTERQVKI 126 >SB_39723| Best HMM Match : Homeobox (HMM E-Value=5.4e-32) Length = 257 Score = 36.3 bits (80), Expect = 0.007 Identities = 20/46 (43%), Positives = 28/46 (60%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 RR RT F+++QL LER F +Y R ELA L L+E +V++ Sbjct: 107 RRPRTAFSSHQLLALERQFQLHKYLTRPQRYELATSLMLTETQVKI 152 >SB_10407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 36.3 bits (80), Expect = 0.007 Identities = 19/49 (38%), Positives = 30/49 (61%) Query: 58 RKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 + +R RT++T QL ELE+ F +Y R ELA ++L+E +V+V Sbjct: 97 KHTKRYRTSYTNRQLLELEKEFHYNKYLCGTRRRELANAMKLTERQVKV 145 >SB_34953| Best HMM Match : Homeobox (HMM E-Value=1e-25) Length = 200 Score = 35.9 bits (79), Expect = 0.010 Identities = 17/47 (36%), Positives = 29/47 (61%) Query: 59 KVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 K RR RT FT++QL LE F ++Y + R+ +A L+L+ +++ Sbjct: 95 KKRRKRTAFTSFQLKCLEDKFKFSKYLTIAERDMMARSLQLTNRQIK 141 >SB_21878| Best HMM Match : Homeobox (HMM E-Value=1.5e-25) Length = 99 Score = 35.9 bits (79), Expect = 0.010 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Query: 55 GRPRKVRR-SRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 G+P++ R SR FT Q LE+ F +Y + R +LA L LSE +V+V Sbjct: 1 GKPQRRRPWSRPVFTQLQRRGLEKRFQVQKYITIHDRYQLAAMLGLSETQVKV 53 >SB_10703| Best HMM Match : Homeobox (HMM E-Value=4.6e-08) Length = 531 Score = 35.9 bits (79), Expect = 0.010 Identities = 20/43 (46%), Positives = 25/43 (58%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEAR 103 RR RT F+ QL LER F +QY R+ LA +L LSE + Sbjct: 468 RRGRTVFSAQQLQVLERVFAGSQYIVGSQRKFLASQLRLSETQ 510 >SB_8774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 223 Score = 35.5 bits (78), Expect = 0.013 Identities = 18/45 (40%), Positives = 27/45 (60%) Query: 62 RSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 R R +T QL ELE+ F T+Y R E+A L+L+E +V++ Sbjct: 150 RKRMAYTRIQLLELEKEFHFTRYLTKERRTEMARMLDLTERQVKI 194 >SB_7899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 35.5 bits (78), Expect = 0.013 Identities = 17/46 (36%), Positives = 26/46 (56%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 ++ R FT Q++ELER F QY RE LA + L+ +V++ Sbjct: 125 KKKRILFTRSQIYELERRFRVQQYLSAPEREHLARMISLTPVQVKI 170 >SB_55403| Best HMM Match : Homeobox (HMM E-Value=8e-07) Length = 243 Score = 35.5 bits (78), Expect = 0.013 Identities = 18/48 (37%), Positives = 25/48 (52%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQVGA 108 ++ R FT Q++ELER F QY RE LA + L E +G+ Sbjct: 8 KKKRILFTRSQIYELERRFRVQQYLSAPEREHLARMISLEERMPGIGS 55 >SB_45591| Best HMM Match : Homeobox (HMM E-Value=7.3e-18) Length = 293 Score = 35.5 bits (78), Expect = 0.013 Identities = 17/47 (36%), Positives = 25/47 (53%) Query: 60 VRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 ++R R T Q LE A+ +YP + R+ L +LSE R+QV Sbjct: 168 IKRKRRNLTKRQQKILETAYSTIKYPTIEDRQRLETSTQLSEDRIQV 214 >SB_8063| Best HMM Match : Homeobox (HMM E-Value=8.5e-24) Length = 963 Score = 35.5 bits (78), Expect = 0.013 Identities = 20/50 (40%), Positives = 27/50 (54%) Query: 57 PRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 P K R+ R FT Q LER F + +Y REELA L+ A+V++ Sbjct: 88 PPKKRKRRILFTKAQTFILERRFTQQRYLSAPEREELARIANLTPAQVKI 137 >SB_30811| Best HMM Match : Homeobox (HMM E-Value=2.5e-26) Length = 133 Score = 35.1 bits (77), Expect = 0.017 Identities = 18/50 (36%), Positives = 30/50 (60%) Query: 57 PRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 P ++ R TFT QL ELE+ F ++Y R E+A L+L+E ++++ Sbjct: 19 PSPSQKKRFTFTQRQLVELEKEFHFSKYLTRTRRIEIATTLKLTEMQIKI 68 >SB_29536| Best HMM Match : Homeobox (HMM E-Value=2.6e-30) Length = 179 Score = 35.1 bits (77), Expect = 0.017 Identities = 21/46 (45%), Positives = 26/46 (56%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 +RSRT+FT QL LE F Y R +LA L LSE +V+V Sbjct: 111 KRSRTSFTPAQLDRLEDEFRVDMYVVGLKRMKLANDLNLSERQVKV 156 >SB_22129| Best HMM Match : Homeobox (HMM E-Value=4.6e-26) Length = 366 Score = 35.1 bits (77), Expect = 0.017 Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Query: 58 RKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 RK +R R FT Q+ ELER F + +Y RE+LA ++L+ +V++ Sbjct: 223 RKKKR-RILFTKSQIFELERRFRQQKYLSANEREQLARIIDLTPTQVKI 270 >SB_53178| Best HMM Match : Homeobox (HMM E-Value=2.5e-26) Length = 428 Score = 35.1 bits (77), Expect = 0.017 Identities = 18/50 (36%), Positives = 30/50 (60%) Query: 57 PRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 P ++ R TFT QL ELE+ F ++Y R E+A L+L+E ++++ Sbjct: 246 PSPSQKKRFTFTQRQLVELEKEFHFSKYLTRTRRIEIATTLKLTEMQIKI 295 >SB_41100| Best HMM Match : Homeobox (HMM E-Value=1.5e-24) Length = 103 Score = 35.1 bits (77), Expect = 0.017 Identities = 18/45 (40%), Positives = 28/45 (62%) Query: 62 RSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 R+RT +T Q ELE+ F ++Y R+ELA L+LSE +++ Sbjct: 20 RARTAYTASQQLELEKEFLYSRYITRTRRKELANTLDLSEKHIKI 64 >SB_11160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 35.1 bits (77), Expect = 0.017 Identities = 17/48 (35%), Positives = 31/48 (64%) Query: 59 KVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 K + +R TF+ +Q+ LE+ F++T+Y R LA L ++E++V+V Sbjct: 134 KRKHTRPTFSGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKV 181 >SB_45690| Best HMM Match : Homeobox (HMM E-Value=4.6e-31) Length = 255 Score = 34.7 bits (76), Expect = 0.022 Identities = 17/46 (36%), Positives = 27/46 (58%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 +R RT +T QL ELE+ F + R E+A +L L+E +V++ Sbjct: 136 KRKRTAYTRKQLLELEKEFHFNHFLTKERRSEMASQLNLTERQVKI 181 >SB_16156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 34.7 bits (76), Expect = 0.022 Identities = 17/46 (36%), Positives = 27/46 (58%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 +R RT +T QL ELE+ F + R E+A +L L+E +V++ Sbjct: 136 KRKRTAYTRKQLLELEKEFHFNHFLTKERRSEMASQLNLTERQVKI 181 >SB_32587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 34.7 bits (76), Expect = 0.022 Identities = 18/45 (40%), Positives = 29/45 (64%) Query: 62 RSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 ++RT ++T QL ELE+ F +Y R E+A LEL+E +V++ Sbjct: 70 KNRTIYSTRQLVELEKEFHYNRYLCRPRRIEIAQSLELTEKQVKI 114 >SB_47662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 33.9 bits (74), Expect = 0.039 Identities = 17/45 (37%), Positives = 26/45 (57%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 ++ RT FT Q+ ELE+ F +Y R ELA L L++ +V+ Sbjct: 403 KKPRTAFTESQISELEKRFQSQKYLGSKERSELAGTLGLTDTQVK 447 >SB_23338| Best HMM Match : Homeobox (HMM E-Value=3.1e-26) Length = 275 Score = 33.5 bits (73), Expect = 0.051 Identities = 13/45 (28%), Positives = 30/45 (66%) Query: 61 RRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 +++R++F+ Q+ LE+ F+ QY R++LA+ L +++ +V+ Sbjct: 99 KKNRSSFSAEQVFRLEKTFELQQYLGTKERQQLALALNMTDNQVK 143 >SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) Length = 245 Score = 33.1 bits (72), Expect = 0.068 Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 53 DAGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 D + + R+ F+ Q+++LER F QY R E+A L +S+ +V++ Sbjct: 72 DPAPDKSTKPRRSFFSADQVNQLERVFAAHQYVSANERAEIAETLNMSDDQVKI 125 >SB_45417| Best HMM Match : Homeobox (HMM E-Value=5.1e-09) Length = 216 Score = 32.7 bits (71), Expect = 0.090 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Query: 49 LEAIDAGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 L +D P V S FT+ +L E AF ++P + RE+LA L++ E+R+QV Sbjct: 44 LSHVDCTAPAPVYPSY--FTSPRL-ATEGAFQYERFPGIQIREKLARELDIDESRIQV 98 >SB_2217| Best HMM Match : LIM (HMM E-Value=1.2e-40) Length = 434 Score = 32.7 bits (71), Expect = 0.090 Identities = 21/57 (36%), Positives = 26/57 (45%) Query: 50 EAIDAGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 E +DA K R RTT QL L+ F T P RE+LA L+ +QV Sbjct: 143 EDLDAALASKRRGPRTTIKAKQLEALKSTFAATPKPSRNIREKLAQETGLNMRVIQV 199 >SB_8775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 464 Score = 32.3 bits (70), Expect = 0.12 Identities = 17/42 (40%), Positives = 24/42 (57%) Query: 64 RTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 R+ FTT Q E+E+ F Y R E+ M L+LSE +V+ Sbjct: 47 RSAFTTVQQLEIEKEFLYDHYVSRVRRIEIVMALDLSEKQVR 88 >SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 31.9 bits (69), Expect = 0.16 Identities = 16/53 (30%), Positives = 28/53 (52%) Query: 53 DAGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 D + + R+ F+ Q+++LER F QY R E+A L +S+ +V+ Sbjct: 72 DPAPDKSTKPRRSFFSADQVNQLERVFAAHQYVSANERAEIAETLNMSDDQVK 124 >SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) Length = 245 Score = 31.9 bits (69), Expect = 0.16 Identities = 15/53 (28%), Positives = 28/53 (52%) Query: 53 DAGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 DA + + R+ F+ Q+++LER F QY R E+A +++ +V+ Sbjct: 72 DAAPEKSTKPRRSFFSADQVNQLERVFTAQQYVSAKERAEIAETFNMTDDQVK 124 >SB_1883| Best HMM Match : LIM (HMM E-Value=2.20004e-42) Length = 328 Score = 31.9 bits (69), Expect = 0.16 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Query: 51 AIDAGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 ++ +GR K +R RTTFT QL L+ F+ PD E +A LS+ QV Sbjct: 246 SLKSGR-HKAKRVRTTFTEDQLQILQANFNIDSNPDGQDLERIAQLTGLSKRVTQV 300 >SB_40083| Best HMM Match : Homeobox (HMM E-Value=0.00011) Length = 113 Score = 31.5 bits (68), Expect = 0.21 Identities = 16/43 (37%), Positives = 21/43 (48%) Query: 63 SRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 +RT FT YQ L F + Y D T +LA L +S +Q Sbjct: 34 TRTRFTPYQTQVLNETFSSSAYIDASTCGQLARLLGISSRSIQ 76 >SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) Length = 245 Score = 31.1 bits (67), Expect = 0.27 Identities = 15/54 (27%), Positives = 28/54 (51%) Query: 53 DAGRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 D + + R+ F+ Q+ +LER F QY R E+A L +++ +V++ Sbjct: 72 DPAPDKAAKPRRSFFSADQVSQLERVFAARQYVSAKERAEIAETLNMTDDQVKI 125 >SB_58034| Best HMM Match : VWA (HMM E-Value=0) Length = 1203 Score = 30.7 bits (66), Expect = 0.36 Identities = 15/42 (35%), Positives = 25/42 (59%) Query: 64 RTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 R F+ QL LE+ F++ +Y R EL+ LE++E +V+ Sbjct: 1020 RPLFSKTQLSRLEKEFEEKRYLTETKRAELSKDLEMTETQVK 1061 Score = 28.7 bits (61), Expect = 1.5 Identities = 16/50 (32%), Positives = 26/50 (52%) Query: 56 RPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 R K + R F+ QL LE+ F +Y RE+L+ L ++E +V+ Sbjct: 1111 RLAKPTKLRPLFSKTQLSRLEKEFSGNKYLTESKREQLSKDLGMTETQVK 1160 >SB_40906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 30.3 bits (65), Expect = 0.48 Identities = 14/17 (82%), Positives = 16/17 (94%) Query: 90 REELAMRLELSEARVQV 106 RE LAMRL+L+EARVQV Sbjct: 2 REALAMRLDLTEARVQV 18 >SB_25008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 29.9 bits (64), Expect = 0.63 Identities = 17/44 (38%), Positives = 24/44 (54%) Query: 62 RSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 R+RT FT QL LE + +Y R LA LE++E +V+ Sbjct: 155 RTRTHFTERQLKYLETYYSNGRYLSRDERTVLAQALEMTELQVR 198 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 29.1 bits (62), Expect = 1.1 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 3/52 (5%) Query: 55 GRPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQV 106 GRP++VR T+F +QL ++ F PD ++L+ + L++ +QV Sbjct: 418 GRPKRVR---TSFKHHQLRAMKTYFAMNHNPDAKDLKQLSQKTGLTKRVLQV 466 >SB_18528| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) Length = 390 Score = 28.7 bits (61), Expect = 1.5 Identities = 15/47 (31%), Positives = 24/47 (51%) Query: 59 KVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEARVQ 105 K R R F + +LE+ FD+ +Y R LA L ++E +V+ Sbjct: 79 KARNKRPVFHPDVVAQLEQVFDERRYISADQRFALAKELNMTEEQVK 125 >SB_20327| Best HMM Match : LIM (HMM E-Value=4.9e-16) Length = 339 Score = 28.3 bits (60), Expect = 1.9 Identities = 12/37 (32%), Positives = 18/37 (48%) Query: 62 RSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLE 98 R RT QLH L ++ PD +E+L R++ Sbjct: 187 RVRTVLNEKQLHTLRTCYNANPRPDAMMKEQLLPRIQ 223 >SB_58730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1014 Score = 27.9 bits (59), Expect = 2.6 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Query: 66 TFTTYQLHE-LERAFDKTQYPDVFTREELAMRLELSE 101 TFT + HE + A D +Y + T+ ELA+RL +E Sbjct: 43 TFTEHFTHEDVNYAIDDIEYTEGGTKTELALRLARTE 79 >SB_47596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 657 Score = 26.6 bits (56), Expect = 5.9 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Query: 56 RPRKVRRSRTTFTTYQLHELERAFDKTQYPDVFTREELAMRLELSEAR 103 RP VRR RTT +++ F +T +VF +E A L++ R Sbjct: 596 RPGLVRR-RTTLVSFRPPRQSPGFSETSNSEVFEMDEAAFVQYLTDVR 642 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.319 0.132 0.364 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,365,525 Number of Sequences: 59808 Number of extensions: 52121 Number of successful extensions: 199 Number of sequences better than 10.0: 108 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 85 Number of HSP's gapped (non-prelim): 116 length of query: 124 length of database: 16,821,457 effective HSP length: 74 effective length of query: 50 effective length of database: 12,395,665 effective search space: 619783250 effective search space used: 619783250 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -