BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000204-TA|BGIBMGA000204-PA|IPR003822|Paired amphipathic helix, IPR013194|Histone deacetylase interacting (1039 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value S78458-1|AAB34402.1| 46|Apis mellifera apamin protein. 27 0.79 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 27 0.79 >S78458-1|AAB34402.1| 46|Apis mellifera apamin protein. Length = 46 Score = 27.1 bits (57), Expect = 0.79 Identities = 11/32 (34%), Positives = 19/32 (59%) Query: 358 NFLRCLLLFTNEIISSSELLSVTSPFLCRHPE 389 + LRC+ LF + I+ +S ++ P C+ PE Sbjct: 3 SMLRCIYLFLSVILITSYFVTPVMPCNCKAPE 34 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 27.1 bits (57), Expect = 0.79 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Query: 547 SRMSGEDAARY-RLDDCLGGHSPTVHQRALRRIYGDKVAVDIIAG 590 S +S D+AR+ R+ C G H+ T H R L I G +++G Sbjct: 389 SIVSSPDSARHQRIGGCNGLHTTTAHNRFLGGIGGYNGLPTVMSG 433 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.318 0.134 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 242,721 Number of Sequences: 429 Number of extensions: 9073 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 2 length of query: 1039 length of database: 140,377 effective HSP length: 65 effective length of query: 974 effective length of database: 112,492 effective search space: 109567208 effective search space used: 109567208 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -