BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000203-TA|BGIBMGA000203-PA|undefined (158 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 24 0.70 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 21 3.7 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 21 3.7 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 21 6.5 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 20 8.6 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 23.8 bits (49), Expect = 0.70 Identities = 11/37 (29%), Positives = 20/37 (54%) Query: 58 KPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQP 94 K PE +E + +EK + K+ S+S + + P+P Sbjct: 75 KKPENVKKEDESDEEKPTTSFKLKDSSSDSEDERPRP 111 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 21.4 bits (43), Expect = 3.7 Identities = 10/38 (26%), Positives = 19/38 (50%) Query: 73 KVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQIL 110 + + +K + TSA+ + P PE R ++ Q + L Sbjct: 19 RAKIVKVAASPTSANPDEEPDPELLDRYDNFYQTTKSL 56 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 21.4 bits (43), Expect = 3.7 Identities = 10/38 (26%), Positives = 19/38 (50%) Query: 73 KVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQIL 110 + + +K + TSA+ + P PE R ++ Q + L Sbjct: 19 RAKIVKVAASPTSANPDEEPDPELLDRYDNFYQTTKSL 56 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 20.6 bits (41), Expect = 6.5 Identities = 14/45 (31%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Query: 51 PERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTS-ADQSKSPQP 94 PE Y P PP P Q +S ++S S + KS +P Sbjct: 26 PEPYPPRCPPIYEPSCQYSPVSNSDSENSEVSSNSYTPKIKSCRP 70 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 20.2 bits (40), Expect = 8.6 Identities = 10/34 (29%), Positives = 17/34 (50%) Query: 59 PPELSPEEQQKRQEKVESIKKMLTSTSADQSKSP 92 PPE +P + + + +I ++ ST KSP Sbjct: 34 PPEDTPLSFKNIESHLNAISQITNSTLDPGRKSP 67 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.311 0.127 0.348 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,754 Number of Sequences: 317 Number of extensions: 1393 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 158 length of database: 114,650 effective HSP length: 52 effective length of query: 106 effective length of database: 98,166 effective search space: 10405596 effective search space used: 10405596 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (20.9 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -