BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000203-TA|BGIBMGA000203-PA|undefined (158 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21400| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_40929| Best HMM Match : Attractin (HMM E-Value=5.1) 35 0.027 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 33 0.082 SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_30201| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.19 SB_22720| Best HMM Match : KID (HMM E-Value=0.0014) 32 0.19 SB_18707| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.19 SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.19 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 32 0.25 SB_38991| Best HMM Match : Utp12 (HMM E-Value=0.98) 32 0.25 SB_56336| Best HMM Match : Ag332 (HMM E-Value=5.1) 31 0.33 SB_55324| Best HMM Match : zf-CCHC (HMM E-Value=0.00014) 31 0.33 SB_47581| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.33 SB_41539| Best HMM Match : PUD (HMM E-Value=0.42) 31 0.33 SB_38797| Best HMM Match : Extensin_2 (HMM E-Value=2.3) 31 0.33 SB_26936| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.33 SB_15610| Best HMM Match : DUF1174 (HMM E-Value=7.8) 31 0.33 SB_48091| Best HMM Match : Coronavirus_5 (HMM E-Value=7.4) 31 0.44 SB_28831| Best HMM Match : GCK (HMM E-Value=3.1) 31 0.44 SB_5351| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_3902| Best HMM Match : Coronavirus_5 (HMM E-Value=9.7) 31 0.44 SB_43495| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 31 0.44 SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_3154| Best HMM Match : DUF812 (HMM E-Value=1.8) 31 0.44 SB_50641| Best HMM Match : Rad21_Rec8_N (HMM E-Value=0) 31 0.58 SB_13878| Best HMM Match : Vicilin_N (HMM E-Value=0.2) 30 0.76 SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) 30 0.76 SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.76 SB_20306| Best HMM Match : Vicilin_N (HMM E-Value=1.8) 30 0.76 SB_11458| Best HMM Match : GTP_CDC (HMM E-Value=2.6e-09) 30 0.76 SB_22296| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) 30 1.0 SB_39578| Best HMM Match : DUF1213 (HMM E-Value=0.032) 30 1.0 SB_36312| Best HMM Match : Ion_trans (HMM E-Value=0) 29 1.3 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 29 1.3 SB_44905| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) 29 1.3 SB_24447| Best HMM Match : TolA (HMM E-Value=1.3) 29 1.3 SB_10683| Best HMM Match : Stathmin (HMM E-Value=0.0011) 29 1.3 SB_1172| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_57079| Best HMM Match : DUF1140 (HMM E-Value=3.8) 29 1.8 SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) 29 1.8 SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_49353| Best HMM Match : AfsA (HMM E-Value=5.5) 29 1.8 SB_45203| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_41311| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_29786| Best HMM Match : I-set (HMM E-Value=0) 29 1.8 SB_7444| Best HMM Match : Transposase_1 (HMM E-Value=9.4) 29 1.8 SB_3581| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 29 1.8 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_10877| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_59689| Best HMM Match : Pkinase (HMM E-Value=0.007) 29 2.3 SB_33494| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_26060| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 29 2.3 SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_11869| Best HMM Match : Excalibur (HMM E-Value=8) 29 2.3 SB_4588| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_39156| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_26950| Best HMM Match : TBC (HMM E-Value=5.2e-28) 29 2.3 SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 29 2.3 SB_1091| Best HMM Match : Cupin_4 (HMM E-Value=0) 29 2.3 SB_59712| Best HMM Match : SAP (HMM E-Value=3e-13) 28 3.1 SB_52732| Best HMM Match : M (HMM E-Value=0.019) 28 3.1 SB_49862| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_31639| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_26577| Best HMM Match : Vicilin_N (HMM E-Value=1.5) 28 3.1 SB_22299| Best HMM Match : Protamine_P2 (HMM E-Value=2.4) 28 3.1 SB_18951| Best HMM Match : EGF (HMM E-Value=2.1e-06) 28 3.1 SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_52883| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_36987| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_10763| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_55427| Best HMM Match : E-MAP-115 (HMM E-Value=0.077) 28 4.1 SB_34146| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_30139| Best HMM Match : E-MAP-115 (HMM E-Value=0.072) 28 4.1 SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_16838| Best HMM Match : TolA (HMM E-Value=2) 28 4.1 SB_14492| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_47950| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_46305| Best HMM Match : SSDP (HMM E-Value=2) 28 4.1 SB_38433| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 28 4.1 SB_36388| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_23891| Best HMM Match : P60 (HMM E-Value=2.2) 28 4.1 SB_12397| Best HMM Match : Extensin_2 (HMM E-Value=0.14) 28 4.1 SB_4695| Best HMM Match : SAM_1 (HMM E-Value=0.012) 28 4.1 SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) 28 4.1 SB_58015| Best HMM Match : rve (HMM E-Value=0.00087) 27 5.4 SB_53775| Best HMM Match : Involucrin2 (HMM E-Value=7.1e-12) 27 5.4 SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) 27 5.4 SB_49054| Best HMM Match : Chordopox_A30L (HMM E-Value=4.1) 27 5.4 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 27 5.4 SB_13303| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_11112| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_56331| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_53144| Best HMM Match : RVT_thumb (HMM E-Value=0.14) 27 5.4 SB_34223| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_10576| Best HMM Match : La (HMM E-Value=6.9e-28) 27 5.4 SB_864| Best HMM Match : Sulfotransfer_1 (HMM E-Value=6.4e-05) 27 5.4 SB_53695| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_41786| Best HMM Match : AT_hook (HMM E-Value=0.24) 27 7.1 SB_41092| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_31801| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_24117| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_23319| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_1181| Best HMM Match : DUF1604 (HMM E-Value=0) 27 7.1 SB_58058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 27 7.1 SB_53565| Best HMM Match : Amino_oxidase (HMM E-Value=9.7e-19) 27 7.1 SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) 27 7.1 SB_47113| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_31312| Best HMM Match : DUF740 (HMM E-Value=1.4) 27 7.1 SB_24031| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_621| Best HMM Match : SNF2_N (HMM E-Value=0) 27 7.1 SB_59580| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_58624| Best HMM Match : E-MAP-115 (HMM E-Value=0.24) 27 9.4 SB_58489| Best HMM Match : Ank (HMM E-Value=4.7e-08) 27 9.4 SB_47780| Best HMM Match : CBM_3 (HMM E-Value=1.8) 27 9.4 SB_42381| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_38330| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_35649| Best HMM Match : M (HMM E-Value=6e-09) 27 9.4 SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) 27 9.4 SB_25350| Best HMM Match : Collagen (HMM E-Value=0) 27 9.4 SB_20537| Best HMM Match : Vicilin_N (HMM E-Value=2.6) 27 9.4 SB_20363| Best HMM Match : Involucrin (HMM E-Value=0.31) 27 9.4 SB_18982| Best HMM Match : M (HMM E-Value=1.1e-06) 27 9.4 SB_13921| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) 27 9.4 SB_9343| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_3000| Best HMM Match : Extensin_2 (HMM E-Value=0.058) 27 9.4 SB_48178| Best HMM Match : RVT_1 (HMM E-Value=0.013) 27 9.4 SB_40403| Best HMM Match : Vicilin_N (HMM E-Value=0.012) 27 9.4 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 27 9.4 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_5548| Best HMM Match : PT (HMM E-Value=3.1) 27 9.4 SB_3143| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_21400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1531 Score = 36.7 bits (81), Expect = 0.009 Identities = 32/112 (28%), Positives = 57/112 (50%), Gaps = 7/112 (6%) Query: 37 TIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIK-KMLTSTSADQS-KSPQP 94 T++ LL +++V + + +L E + Q+K +S+K K DQ+ K + Sbjct: 949 TLEDLLDTSKRVVEEKEQKVTELDKLLNESVDELQQKDKSLKEKDGKLAELDQALKESRK 1008 Query: 95 EEKRRREHLLQMNQILAKQVTEM-SKIIAVKAWEELPLNQSDHEAEDRSPDV 145 E K R + QM+ + +Q TE+ K +A+ E LNQS HE +R+ ++ Sbjct: 1009 EIKNREAQVSQMDSSMREQKTEIYQKTMAL----EQNLNQSRHELSERAVEI 1056 >SB_40929| Best HMM Match : Attractin (HMM E-Value=5.1) Length = 566 Score = 35.1 bits (77), Expect = 0.027 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Query: 58 KPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKR-RREHLLQMNQILAKQVTE 116 KP E + +EQ K+ + S K T TS Q K Q E+K+ R+ ++ Q K+ T Sbjct: 259 KPQEKNKQEQDKQAARQASRKTSKTKTSKPQEKDKQDEDKQAARKRQVRTRQASRKKKTS 318 Query: 117 MSK 119 +K Sbjct: 319 TNK 321 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 33.5 bits (73), Expect = 0.082 Identities = 27/87 (31%), Positives = 41/87 (47%), Gaps = 7/87 (8%) Query: 5 VDDADMERALRGAAPDVVRSALPPRDLRRADNTIDQLLAAPQKIVIPER--YIPEKPP-E 61 VD+A E A R +P R P DL++ + + A P I PER Y E P E Sbjct: 2726 VDEALSESAFRAQSP---RETASPPDLKKDEEDKAVIAAMPSPITEPERKVYKEELPSYE 2782 Query: 62 LSPEEQQKRQEK-VESIKKMLTSTSAD 87 +P++ QE+ ++ I+ +AD Sbjct: 2783 SAPDKMDNGQEEMLDEIEAATAEKTAD 2809 Score = 28.7 bits (61), Expect = 2.3 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 3/72 (4%) Query: 71 QEKVESIKKMLTSTSAD-QSKSPQPEEKRRREHLLQMNQILAK--QVTEMSKIIAVKAWE 127 +E VE +KK + +++ PQPEEK + E ++ + Q E KI + E Sbjct: 541 EEDVEKVKKEQPQPEEEFKTEQPQPEEKFKTEQPQPKEEVKIEQPQPEEEFKIEQPQPKE 600 Query: 128 ELPLNQSDHEAE 139 E+ + Q E E Sbjct: 601 EVKIEQPQPEEE 612 >SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 33.1 bits (72), Expect = 0.11 Identities = 30/94 (31%), Positives = 53/94 (56%), Gaps = 9/94 (9%) Query: 52 ERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQM-NQIL 110 E+ I EK L E+Q++ E + +K++L AD+ ++ + EEKR+RE L+M QI Sbjct: 238 EQRIAEKRKRL---EEQRKVESLHLLKELLKRV-ADK-RAEEEEEKRKREKELEMLRQIE 292 Query: 111 AK--QVTEMSKI-IAVKAWEELPLNQSDHEAEDR 141 K ++ E +I V+ +++ L Q + E D+ Sbjct: 293 EKKRKLEEEERIKEEVEKQKKIKLEQQEKELRDK 326 >SB_30201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 32.3 bits (70), Expect = 0.19 Identities = 26/128 (20%), Positives = 59/128 (46%), Gaps = 5/128 (3%) Query: 27 PPRDLRRADNTIDQLLA-APQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTS 85 P R R+ + I+ L A + + E+ + K E+ ++ Q +Q+ E ++ M+ Sbjct: 16 PKRQRRKGGDAIEFLKERADKNSELREKELNMKK-EMQQQQLQLQQKNTEMMQAMVQQQQ 74 Query: 86 ADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIAVKAWEELPLNQ-SDHEAEDRSPD 144 Q + QP++++ ++ LQ Q+ +Q+ + + ++L Q + + + P Sbjct: 75 QQQQQ--QPQQQQPQQQQLQQQQLQQQQLQQQQLQQQQQQQQQLQQQQPQQQQQQQQQPQ 132 Query: 145 VELPIYQQ 152 + P QQ Sbjct: 133 QQQPQQQQ 140 Score = 29.5 bits (63), Expect = 1.3 Identities = 10/57 (17%), Positives = 32/57 (56%) Query: 65 EEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKII 121 ++QQ++Q++++ + Q + QP++++ ++ LQ Q+ +Q+ + ++ Sbjct: 107 QQQQQQQQQLQQQQPQQQQQQQQQPQQQQPQQQQLQQQQLQQQQLQQQQLQQQQMLM 163 Score = 26.6 bits (56), Expect = 9.4 Identities = 12/72 (16%), Positives = 41/72 (56%), Gaps = 4/72 (5%) Query: 45 PQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLL 104 PQ+ + ++ + ++ +L ++ Q++Q++ + +++ Q + QP++++ ++ L Sbjct: 86 PQQQQLQQQQLQQQ--QLQQQQLQQQQQQQQQLQQQ--QPQQQQQQQQQPQQQQPQQQQL 141 Query: 105 QMNQILAKQVTE 116 Q Q+ +Q+ + Sbjct: 142 QQQQLQQQQLQQ 153 >SB_22720| Best HMM Match : KID (HMM E-Value=0.0014) Length = 847 Score = 32.3 bits (70), Expect = 0.19 Identities = 32/132 (24%), Positives = 63/132 (47%), Gaps = 12/132 (9%) Query: 9 DMERALRGAAPDVVRSALPPRDLRRADNTIDQLLAAPQKIVIPERYIPEKPPELSPEEQQ 68 D+E + ++ + D++ A + + A ++ I + + EK +S +Q Sbjct: 689 DLEEIIESKDDEIEQLQKRFDDMKNATSADGKRTIALKEKDIEIQKLQEKLEGVSKASEQ 748 Query: 69 KRQ--EKVESIKKMLTSTSAD-QSKSPQPE-EKRRREHLLQMNQILAKQVTEMSKIIAVK 124 + +K+ES+ K + D QS+ + E E R+ HLL++ + +++ + K + Sbjct: 749 SKTHAQKLESLNKEQENKLVDAQSRLEESEAEGRKTAHLLKLKE---QKIESLEKKV--- 802 Query: 125 AWEELPLNQSDH 136 EEL LNQ DH Sbjct: 803 --EELELNQDDH 812 >SB_18707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 32.3 bits (70), Expect = 0.19 Identities = 26/128 (20%), Positives = 59/128 (46%), Gaps = 5/128 (3%) Query: 27 PPRDLRRADNTIDQLLA-APQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTS 85 P R R+ + I+ L A + + E+ + K E+ ++ Q +Q+ E ++ M+ Sbjct: 15 PKRQRRKGGDAIEFLKERADKNSELREKELNMKK-EMQQQQLQLQQKNTEMMQAMVQQQQ 73 Query: 86 ADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIAVKAWEELPLNQ-SDHEAEDRSPD 144 Q + QP++++ ++ LQ Q+ +Q+ + + ++L Q + + + P Sbjct: 74 QQQQQ--QPQQQQPQQQQLQQQQLQQQQLQQQQLQQQQQQQQQLQQQQPQQQQQQQQQPQ 131 Query: 145 VELPIYQQ 152 + P QQ Sbjct: 132 QQQPQQQQ 139 Score = 29.5 bits (63), Expect = 1.3 Identities = 10/57 (17%), Positives = 32/57 (56%) Query: 65 EEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKII 121 ++QQ++Q++++ + Q + QP++++ ++ LQ Q+ +Q+ + ++ Sbjct: 106 QQQQQQQQQLQQQQPQQQQQQQQQPQQQQPQQQQLQQQQLQQQQLQQQQLQQQQMLM 162 Score = 26.6 bits (56), Expect = 9.4 Identities = 12/72 (16%), Positives = 41/72 (56%), Gaps = 4/72 (5%) Query: 45 PQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLL 104 PQ+ + ++ + ++ +L ++ Q++Q++ + +++ Q + QP++++ ++ L Sbjct: 85 PQQQQLQQQQLQQQ--QLQQQQLQQQQQQQQQLQQQ--QPQQQQQQQQQPQQQQPQQQQL 140 Query: 105 QMNQILAKQVTE 116 Q Q+ +Q+ + Sbjct: 141 QQQQLQQQQLQQ 152 >SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 32.3 bits (70), Expect = 0.19 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 11/99 (11%) Query: 14 LRGAAP--DVVRSALPPRDLRRADNTIDQLLAAP-QKIVIPERYIPEKPPELSPEEQQKR 70 L GA P + S+ PP + A L P Q+ +P+ IP PP + P + Sbjct: 122 LTGALPKKEAAASSTPPPPAKEAP-----LPPPPAQQEAVPD--IPTSPPPVPPLPTEPL 174 Query: 71 QEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQI 109 Q+ S +++ +A S S P + R EH ++MN++ Sbjct: 175 QQTTTSAPSLISPAAAG-SPSDAPLQGARSEHRVKMNRM 212 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 31.9 bits (69), Expect = 0.25 Identities = 22/92 (23%), Positives = 43/92 (46%), Gaps = 1/92 (1%) Query: 61 ELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKI 120 E+ E++K ++ +E ++ A Q K + EE+RR++ LL Q +++ + Sbjct: 569 EIQRIEEEKERKTLEKERRE-AEARALQQKQQEEEERRRQQELLLQRQREEEEMRRQQEQ 627 Query: 121 IAVKAWEELPLNQSDHEAEDRSPDVELPIYQQ 152 + + EE + EAE + + E QQ Sbjct: 628 MLQRQREEEERRRQQEEAERQRREQEEVFKQQ 659 Score = 26.6 bits (56), Expect = 9.4 Identities = 18/104 (17%), Positives = 41/104 (39%) Query: 51 PERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQIL 110 P P PP + + + KV+S++++ + K+ + E + LQ Q Sbjct: 541 PTTATPSTPPVNVWDLEANNKSKVQSLQEIQRIEEEKERKTLEKERREAEARALQQKQQE 600 Query: 111 AKQVTEMSKIIAVKAWEELPLNQSDHEAEDRSPDVELPIYQQRD 154 ++ +++ + EE + + + R + E QQ + Sbjct: 601 EEERRRQQELLLQRQREEEEMRRQQEQMLQRQREEEERRRQQEE 644 Score = 26.6 bits (56), Expect = 9.4 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 4/81 (4%) Query: 65 EEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIAVK 124 EE++++QE+ E ++ Q + Q E ++R+ Q Q L K+ E + +A Sbjct: 636 EERRRQQEEAERQRREQEEVFKQQEQQRQQLELQKRQQEQQRQQELQKRQQEEKQRMAEM 695 Query: 125 AWEE----LPLNQSDHEAEDR 141 ++ L L Q E + R Sbjct: 696 RQQQQQALLRLQQQQQEVQRR 716 >SB_38991| Best HMM Match : Utp12 (HMM E-Value=0.98) Length = 809 Score = 31.9 bits (69), Expect = 0.25 Identities = 13/40 (32%), Positives = 25/40 (62%) Query: 45 PQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTST 84 P++ IP++ ++ +P + +K+QEK E IK+M+ T Sbjct: 573 PREESIPQQTTSKRDESKTPSQHRKQQEKKEQIKEMVAET 612 >SB_56336| Best HMM Match : Ag332 (HMM E-Value=5.1) Length = 366 Score = 31.5 bits (68), Expect = 0.33 Identities = 26/104 (25%), Positives = 48/104 (46%), Gaps = 6/104 (5%) Query: 52 ERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQP-EEKRRREHLLQMNQIL 110 E + E+P + P E++ +QE+ K ++ K +P EE++++E ++ Sbjct: 58 EEPVKEEPKQEEPVEEEPKQEEPVEQKPKQEEPVEEEPKQEEPVEEEQKQEEPVKEEPKQ 117 Query: 111 AKQVTEMSKIIAVKAWEELPLNQSDHEAEDRSPDVELPIYQQRD 154 QV E K+ + EE P + E E P E P +Q++ Sbjct: 118 EGQVEEEPKL--EEPVEEEPKQEEPVEEE---PKQEEPFEEQKE 156 Score = 29.1 bits (62), Expect = 1.8 Identities = 21/105 (20%), Positives = 48/105 (45%), Gaps = 4/105 (3%) Query: 52 ERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQP-EEKRRREHLLQMNQIL 110 E + E+P + P E++ RQE+ + ++ ++ K +P EE+ ++E ++ Sbjct: 222 EEIVEEEPKQEGPVEEETRQEEPDEKEREQEELVEEEPKKEEPVEEETKQEEPVEEEPKQ 281 Query: 111 AKQVTEMSK---IIAVKAWEELPLNQSDHEAEDRSPDVELPIYQQ 152 + V E K + + +E + + E + P E P+ ++ Sbjct: 282 EEAVDEEPKKEEQVDGEPKQEEQVEELKQEEQIEEPKQEEPVEEE 326 Score = 28.3 bits (60), Expect = 3.1 Identities = 21/102 (20%), Positives = 44/102 (43%), Gaps = 2/102 (1%) Query: 52 ERYIPEKPPELSP-EEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQIL 110 E + E+P + P EE+QK++E V+ K + EE+ ++E ++ Sbjct: 88 EEPVEEEPKQEEPVEEEQKQEEPVKEEPKQEGQVEEEPKLEEPVEEEPKQEEPVEEEPKQ 147 Query: 111 AKQVTEMSKIIAVKAWEELPLNQSDHEAEDRSPDVELPIYQQ 152 + E + +A ++ + P+ D P E P+ ++ Sbjct: 148 EEPFEEQKEAVAEESKVDAPV-AIDTSGVYEKPKQEQPVEEK 188 Score = 27.9 bits (59), Expect = 4.1 Identities = 21/103 (20%), Positives = 47/103 (45%), Gaps = 6/103 (5%) Query: 57 EKPPELSP-EEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQ---MNQILAK 112 EK + P EE+ K++E +E K + + Q EE+ ++E ++ + K Sbjct: 3 EKQKQEQPVEEESKQEEPIEEGPKQKELVEEEPKQEEQVEEEPKQEEPVEEEPKQEEPVK 62 Query: 113 QVTEMSKIIAVKAWEELPLNQSDHEAE--DRSPDVELPIYQQR 153 + + + + + +E P+ Q + E + P E P+ +++ Sbjct: 63 EEPKQEEPVEEEPKQEEPVEQKPKQEEPVEEEPKQEEPVEEEQ 105 Score = 26.6 bits (56), Expect = 9.4 Identities = 22/102 (21%), Positives = 46/102 (45%), Gaps = 6/102 (5%) Query: 52 ERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQP-EEKRRREHLLQMNQIL 110 E + E+P + P E++ +QE+ + ++ K +P E+K ++E ++ Sbjct: 38 EEQVEEEPKQEEPVEEEPKQEEPVKEEPKQEEPVEEEPKQEEPVEQKPKQEEPVEEEPKQ 97 Query: 111 AKQVTEMSKIIAVKAWEELPLNQSDHEAEDRSPDVELPIYQQ 152 + V E K + +E P + E E P +E P+ ++ Sbjct: 98 EEPVEEEQK--QEEPVKEEPKQEGQVEEE---PKLEEPVEEE 134 >SB_55324| Best HMM Match : zf-CCHC (HMM E-Value=0.00014) Length = 344 Score = 31.5 bits (68), Expect = 0.33 Identities = 22/95 (23%), Positives = 43/95 (45%), Gaps = 4/95 (4%) Query: 51 PERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRR---EHLLQMN 107 P R + ++ +E +V +++LT + Q + +K++R H+ Q Sbjct: 212 PRRSAAVREVDVEEKEADVSCSEVAGRRRVLTDLISGQKLLAEEMQKQQRTLMSHIDQQR 271 Query: 108 QILAKQVTEMSKIIAVKAWE-ELPLNQSDHEAEDR 141 QIL +Q +++++A AW P N E+R Sbjct: 272 QILTQQQQTLNQLLAAVAWRPRSPSNSCYDCGEER 306 >SB_47581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 31.5 bits (68), Expect = 0.33 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Query: 56 PEKPPELSPEEQQKRQE-KVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQV 114 P PP SP+E + + K KKM TS S + PE +R +E L + +L + V Sbjct: 19 PPSPPPPSPKESYRIEHVKTRKSKKMGTSCSDYVVRVDLPERQRLQEALDDVEGVLGRDV 78 >SB_41539| Best HMM Match : PUD (HMM E-Value=0.42) Length = 1582 Score = 31.5 bits (68), Expect = 0.33 Identities = 25/118 (21%), Positives = 51/118 (43%), Gaps = 3/118 (2%) Query: 28 PRDLRRADNTIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSAD 87 P +++R T +LL + + + P + + E + R+ K S +S+S+ Sbjct: 1185 PSEMQRFSLTASELLKPECVLELADGMRPPEEISIEVTETETRERKDSSSSS--SSSSSS 1242 Query: 88 QSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIAVKAWEELPLNQSDHEAEDRSPDV 145 S + EEK ++E K+ E + AV+ E+ +++ E E+ D+ Sbjct: 1243 SSDEEKDEEK-KKEKKAAKKAAKKKRKAEAAAAAAVEVGVEVKEGENEEEEEEVKKDI 1299 >SB_38797| Best HMM Match : Extensin_2 (HMM E-Value=2.3) Length = 308 Score = 31.5 bits (68), Expect = 0.33 Identities = 20/90 (22%), Positives = 35/90 (38%), Gaps = 2/90 (2%) Query: 7 DADMERALRGAAPDVVRSALPPRDLRRADNTIDQLLAAPQKIVIPERYIPEKP--PELSP 64 D+ E ++ +A V SA PP D T + + ++ + PE+P E +P Sbjct: 67 DSHQEEVVQSSAEVVAESAPPPAQTETEDTTTPEEVKELSNVLDEQDTKPEEPAEAETAP 126 Query: 65 EEQQKRQEKVESIKKMLTSTSADQSKSPQP 94 E + E + T + P+P Sbjct: 127 EAVESVPEPAHEVVSESAPTEPPKPTEPEP 156 >SB_26936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 31.5 bits (68), Expect = 0.33 Identities = 25/118 (21%), Positives = 51/118 (43%), Gaps = 3/118 (2%) Query: 28 PRDLRRADNTIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSAD 87 P +++R T +LL + + + P + + E + R+ K S +S+S+ Sbjct: 200 PSEMQRFSLTASELLKPECVLELADGMRPPEEISIEVTETETRERKDSSSSS--SSSSSS 257 Query: 88 QSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIAVKAWEELPLNQSDHEAEDRSPDV 145 S + EEK ++E K+ E + AV+ E+ +++ E E+ D+ Sbjct: 258 SSDEEKDEEK-KKEKKAAKKAAKKKRKAEAAAAAAVEVGVEVKEGENEEEEEEVKKDI 314 >SB_15610| Best HMM Match : DUF1174 (HMM E-Value=7.8) Length = 200 Score = 31.5 bits (68), Expect = 0.33 Identities = 20/90 (22%), Positives = 35/90 (38%), Gaps = 2/90 (2%) Query: 7 DADMERALRGAAPDVVRSALPPRDLRRADNTIDQLLAAPQKIVIPERYIPEKP--PELSP 64 D+ E ++ +A V SA PP D T + + ++ + PE+P E +P Sbjct: 67 DSHQEEVVQSSAEVVAESAPPPAQTETEDTTTPEEVKELSNVLDEQDTKPEEPAEAETAP 126 Query: 65 EEQQKRQEKVESIKKMLTSTSADQSKSPQP 94 E + E + T + P+P Sbjct: 127 EAVESVPEPAHEVVSESAPTEPPKPTEPEP 156 >SB_48091| Best HMM Match : Coronavirus_5 (HMM E-Value=7.4) Length = 141 Score = 31.1 bits (67), Expect = 0.44 Identities = 20/87 (22%), Positives = 40/87 (45%), Gaps = 4/87 (4%) Query: 27 PPRDLRRADNTIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSA 86 P R R+ + I+ L K + EK + E QQ++ + + +M+ + Sbjct: 47 PKRQRRKGGDAIEFLKERADK----NSELREKELNMKKEMQQQQLQLQQKNTEMMQAMVQ 102 Query: 87 DQSKSPQPEEKRRREHLLQMNQILAKQ 113 Q + QP++++ ++ LQ Q+L Q Sbjct: 103 QQQQQQQPQQQQLQQQQLQQQQMLMMQ 129 >SB_28831| Best HMM Match : GCK (HMM E-Value=3.1) Length = 320 Score = 31.1 bits (67), Expect = 0.44 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Query: 56 PEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPE 95 P++ +L E+QQ E+ S KK L + SA SPQPE Sbjct: 67 PKETEQLPTEDQQDGAEEKRSAKK-LPAPSATSQTSPQPE 105 >SB_5351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 870 Score = 31.1 bits (67), Expect = 0.44 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Query: 65 EEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIAVK 124 EEQ+K + K E ++K A Q + E++RR+E + LA+++ ++I A K Sbjct: 459 EEQEKARRKEEEVRKRNEEMKAAQEAKKKQEDRRRKEMDEEREAELARKLD--AEIAAKK 516 Query: 125 A 125 A Sbjct: 517 A 517 >SB_3902| Best HMM Match : Coronavirus_5 (HMM E-Value=9.7) Length = 109 Score = 31.1 bits (67), Expect = 0.44 Identities = 20/87 (22%), Positives = 40/87 (45%), Gaps = 4/87 (4%) Query: 27 PPRDLRRADNTIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSA 86 P R R+ + I+ L K + EK + E QQ++ + + +M+ + Sbjct: 15 PKRQRRKGGDAIEFLKERADK----NSELREKELNMKKEMQQQQLQLQQKNTEMMQAMVQ 70 Query: 87 DQSKSPQPEEKRRREHLLQMNQILAKQ 113 Q + QP++++ ++ LQ Q+L Q Sbjct: 71 QQQQQQQPQQQQLQQQQLQQQQMLMMQ 97 >SB_43495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1994 Score = 31.1 bits (67), Expect = 0.44 Identities = 19/75 (25%), Positives = 33/75 (44%) Query: 24 SALPPRDLRRADNTIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTS 83 S P + L DN L+AA E +P K + + + K++ +E ++ Sbjct: 1544 SVHPAQSLPPIDNKNTSLVAAKIDPSEDEERVPRKRQSKATQRELKQKADIERLRNKQRL 1603 Query: 84 TSADQSKSPQPEEKR 98 ++KS PE+KR Sbjct: 1604 REQRKAKSHSPEDKR 1618 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 31.1 bits (67), Expect = 0.44 Identities = 19/85 (22%), Positives = 43/85 (50%), Gaps = 5/85 (5%) Query: 63 SPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIA 122 S +++ ++++++ K + D K Q +R E N++L+K+V +++ + Sbjct: 1357 SKAREERLKQELQASKNKIAKIEDDHKKIHQQNIERDHE-----NKMLSKRVADLTALKE 1411 Query: 123 VKAWEELPLNQSDHEAEDRSPDVEL 147 E+ + QS EA+ R D+E+ Sbjct: 1412 KFEHEKKEMKQSLREAQGRESDLEV 1436 >SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1126 Score = 31.1 bits (67), Expect = 0.44 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 2/84 (2%) Query: 65 EEQQKRQEKVESIKKMLT-STSAD-QSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIA 122 E+ +K++E+ E K+ L AD ++ Q EE R++ L Q + Q + K Sbjct: 827 EKAKKKKEREEDAKRRLRLQKKADLDARRKQEEETRKQRQLEQEEEAKRHQELLLRKQEF 886 Query: 123 VKAWEELPLNQSDHEAEDRSPDVE 146 + + + ++ H+ E+R D+E Sbjct: 887 EEQERQRKIAEAKHQQEEREKDME 910 Score = 29.9 bits (64), Expect = 1.0 Identities = 21/90 (23%), Positives = 47/90 (52%), Gaps = 2/90 (2%) Query: 66 EQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRRE-HLLQMNQILAKQVTEMSKIIAVK 124 E+++ +EK +K++ ++++ EEK R E ++ Q+L ++ + + +K Sbjct: 910 ERERTEEKARIMKEIEEKEKKEEAERKAKEEKEREERERKRICQLLKEKAEQERRERELK 969 Query: 125 AWEE-LPLNQSDHEAEDRSPDVELPIYQQR 153 A EE L L + E+R ++L + ++R Sbjct: 970 AREEKLRLAREQMMREERERTLKLELERKR 999 >SB_3154| Best HMM Match : DUF812 (HMM E-Value=1.8) Length = 815 Score = 31.1 bits (67), Expect = 0.44 Identities = 22/94 (23%), Positives = 47/94 (50%), Gaps = 6/94 (6%) Query: 31 LRRADNTIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSK 90 ++ +D+ + Q+ PQ + + PEK E++ E K E +++L+ST D+ Sbjct: 528 IKGSDSLLMQIFRRPQLLEKKSSWCPEKGREIAIEAYAKALE-----EEILSSTKQDKIY 582 Query: 91 SPQPEEKRRR-EHLLQMNQILAKQVTEMSKIIAV 123 S +++RR + L I+ K+ + S ++ + Sbjct: 583 SNLTQDERRALKDLRYAKDIVIKEADKGSGVVVI 616 >SB_50641| Best HMM Match : Rad21_Rec8_N (HMM E-Value=0) Length = 816 Score = 30.7 bits (66), Expect = 0.58 Identities = 23/143 (16%), Positives = 62/143 (43%) Query: 4 SVDDADMERALRGAAPDVVRSALPPRDLRRADNTIDQLLAAPQKIVIPERYIPEKPPELS 63 +VD+ +E AL+ P++ +A +L N ++ + P ++V + K + Sbjct: 508 AVDELGLEEALQEPVPEINETANTTNELTIVQNEMEGFVLEPVEVVQKGKRSRRKRKLIV 567 Query: 64 PEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIAV 123 EE+ E +++ + + +P + ++R + ++ ++ A + E+ V Sbjct: 568 DEEKILSTEVIKTQLADTSDIVKPATLAPPTKTRKRLKKRSKVEELFANPMVELFAGPLV 627 Query: 124 KAWEELPLNQSDHEAEDRSPDVE 146 + + E N+ ++ + + E Sbjct: 628 ECFTENLTNKIAEDSAQKEEEEE 650 >SB_13878| Best HMM Match : Vicilin_N (HMM E-Value=0.2) Length = 611 Score = 30.3 bits (65), Expect = 0.76 Identities = 19/89 (21%), Positives = 41/89 (46%) Query: 66 EQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIAVKA 125 ++ R+EK+E +K L + + +++ EH Q L + +E K V++ Sbjct: 74 KKDHRKEKLEERRKKLAELLLQEKTEYELAQQKLYEHWKQNAPELRQIESEQLKEHVVES 133 Query: 126 WEELPLNQSDHEAEDRSPDVELPIYQQRD 154 W E ++++++ R D + +RD Sbjct: 134 WGEQVVDKAENLKTAREEDRRINAVMERD 162 >SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) Length = 1217 Score = 30.3 bits (65), Expect = 0.76 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 6/68 (8%) Query: 52 ERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILA 111 +R I + EL E+++ +K+ ++KK T+ A K PEE + + I+A Sbjct: 565 QREIQRRRQELQDIEKRQAMDKIAALKK--TTVGAKALKDLSPEEIDN----MNADDIIA 618 Query: 112 KQVTEMSK 119 KQV ++ K Sbjct: 619 KQVEQLDK 626 >SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1137 Score = 30.3 bits (65), Expect = 0.76 Identities = 26/111 (23%), Positives = 52/111 (46%), Gaps = 6/111 (5%) Query: 34 ADNTIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQ 93 A T D+ +K+ + I K E EE++KR+E+ ES KK ++ + Sbjct: 1026 AKETFDKTKEGEKKMKDEQDEIERKKAE---EEEKKRKEEEESKKK--DEKEKEEEDEDE 1080 Query: 94 PEEKRRREHLLQMNQILAKQVTEMSKIIAVKAWEELPLNQSDHEAEDRSPD 144 EE+ ++E + + K+ SK ++ E P ++ + ++ED + + Sbjct: 1081 EEEEEKKED-AKTDDSETKEAEPESKEAEPESKEAEPESKEETKSEDETTE 1130 >SB_20306| Best HMM Match : Vicilin_N (HMM E-Value=1.8) Length = 360 Score = 30.3 bits (65), Expect = 0.76 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Query: 56 PEKPPELSPEEQQKRQEKVE---SIKKMLTSTSADQSKSPQPEE 96 PE PE+SP+ +K K S+K+ LT+ + + +PE+ Sbjct: 13 PETSPEISPKTGRKTDRKTSRKTSLKRSLTTNKPEDNADEKPED 56 >SB_11458| Best HMM Match : GTP_CDC (HMM E-Value=2.6e-09) Length = 337 Score = 30.3 bits (65), Expect = 0.76 Identities = 24/104 (23%), Positives = 47/104 (45%), Gaps = 4/104 (3%) Query: 57 EKPPELSPEEQQKRQEKVESIKKMLTSTSA--DQSKSPQPEEKRRREHLLQMNQILAKQV 114 +K ++ QK ++K +KK A D K Q EEK++ E +M ++ K Sbjct: 143 DKEEKMRQRFVQKVKDKENELKKAEQELHAKFDHLKKVQAEEKKKLEEKRKMLSLIDKTH 202 Query: 115 TEMSKIIAVKAWEELPLNQSDHEAEDRSPDVELPIYQQRDNFFT 158 T ++ EE+ N D +A ++S ++ ++R + + Sbjct: 203 TVHYELFRRNKLEEMGFN--DGDANNKSHSLQETYEERRKEYMS 244 >SB_22296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 29.9 bits (64), Expect = 1.0 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Query: 68 QKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIAVKAW 126 Q+ E+V+ ++ ++T T + P E RR+E L + + K E K + AW Sbjct: 111 QENTERVQEMQGVVT-TDRETIDDPNTSESRRQEALGSIANFVFKAAEEAVKFLGENAW 168 >SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) Length = 256 Score = 29.9 bits (64), Expect = 1.0 Identities = 28/131 (21%), Positives = 58/131 (44%), Gaps = 3/131 (2%) Query: 11 ERALRGAAPDVVRSALPPRDLRRADNTIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKR 70 E AL+ A +++ R L R+ +LLA ++ + E+ I + + EE+++R Sbjct: 60 EEALKKAEEEMMLQEHKQRGLERSKQEAQRLLALQEQHLKEEQEIKNEVEKERQEEEKRR 119 Query: 71 QEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIAVKAWEELP 130 E +E + +SK + EE + H + L +Q + + + + EE Sbjct: 120 ME-IEKQRMESEKKRILESKQKRIEESKDTIH--DNEKFLEEQRKRLVEKVKNEGEEERM 176 Query: 131 LNQSDHEAEDR 141 L+ + E++ Sbjct: 177 LHDQRQKEEEQ 187 >SB_39578| Best HMM Match : DUF1213 (HMM E-Value=0.032) Length = 521 Score = 29.9 bits (64), Expect = 1.0 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Query: 56 PEKPPELSPEEQQKRQEKVE---SIKKMLTSTSADQSKSPQPEEK 97 PE PE+SP+ +K K S+ + LT+ + + +PE+K Sbjct: 213 PETSPEISPKTGRKTSRKTSRKTSLNRSLTTNKPEDNADEKPEKK 257 >SB_36312| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 1283 Score = 29.5 bits (63), Expect = 1.3 Identities = 21/86 (24%), Positives = 41/86 (47%), Gaps = 5/86 (5%) Query: 30 DLRRADNTIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQS 89 D ++ D + AAP+K ++ + EK + EE++K +E K+ L + + Sbjct: 1134 DEKKEDEAKNTEAAAPKKKKTLKQILKEKEEQKLLEEKRKAEE-----KQKLEEEDKELT 1188 Query: 90 KSPQPEEKRRREHLLQMNQILAKQVT 115 Q EK RR+ +++ + +L T Sbjct: 1189 PEEQMAEKLRRQKIVEESDLLVAMDT 1214 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 29.5 bits (63), Expect = 1.3 Identities = 19/88 (21%), Positives = 42/88 (47%) Query: 32 RRADNTIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKS 91 +R D +L ++ ER E+ + EE++KR+E+ E+ +K Q + Sbjct: 235 QRLDEERKKLEEEEANLMEEERKRKEEAEKKREEEERKRREEEEAAQKWKKEELLRQQQL 294 Query: 92 PQPEEKRRREHLLQMNQILAKQVTEMSK 119 + +E++ R LQ + A + ++++ Sbjct: 295 EREKEEQERAERLQREREEAMEAEDLAE 322 >SB_44905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 29.5 bits (63), Expect = 1.3 Identities = 25/102 (24%), Positives = 47/102 (46%), Gaps = 6/102 (5%) Query: 57 EKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEK-RRREHLLQMNQILAKQVT 115 E P E K++EK S K L S ++ ++P+P + R+R+HL Q + + Sbjct: 73 ENPYRAREREILKQREKFASYK--LLSDDDEEEEAPKPSQTDRKRKHLRQKTETSSDSSE 130 Query: 116 EMSKIIAVKAWEELPLNQSDHEAE-DRSPDVELPIYQQRDNF 156 + + + P +S+ E E +R + + ++RD F Sbjct: 131 DEGR--GAETSRVSPGGESESEDEWERVENERMKDLEERDAF 170 >SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) Length = 374 Score = 29.5 bits (63), Expect = 1.3 Identities = 18/68 (26%), Positives = 38/68 (55%), Gaps = 8/68 (11%) Query: 46 QKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQ 105 +K+ +++P+K PE EQ K+ K +K+ L +D+ K E+ ++E L + Sbjct: 313 KKVEKSAKHLPQKKPESKKHEQTKKDLKGRKLKRQL----SDKEKI----EEIKKEKLKK 364 Query: 106 MNQILAKQ 113 + +IL+++ Sbjct: 365 VEEILSQK 372 >SB_24447| Best HMM Match : TolA (HMM E-Value=1.3) Length = 325 Score = 29.5 bits (63), Expect = 1.3 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 5/68 (7%) Query: 58 KPPELSPEEQQKRQEKV-ESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTE 116 K ++ E Q+K QEK+ + +K +A+ K +EK R+E Q+ +I+A + E Sbjct: 173 KAEKIELESQKKDQEKLAKEFQKNKKKYAAEIDK----KEKERKEIDKQIKKIIADAIAE 228 Query: 117 MSKIIAVK 124 +K AVK Sbjct: 229 ANKKNAVK 236 >SB_10683| Best HMM Match : Stathmin (HMM E-Value=0.0011) Length = 299 Score = 29.5 bits (63), Expect = 1.3 Identities = 20/102 (19%), Positives = 47/102 (46%), Gaps = 4/102 (3%) Query: 37 TIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEE 96 T ++LLA + + + E S ++K Q+K + K+++ + + + Q E Sbjct: 121 TQEKLLAKDEHVKTVQAQAQVMAEEHSKVTEEKLQQKFAASKEIIEELRSAKEEKLQAHE 180 Query: 97 KRRREHLLQMNQILAKQVTEMSKIIAVKAWEELPLNQSDHEA 138 +R R I +Q+ + SK+I K +++ + + ++ Sbjct: 181 RRVR----VAQSIAQEQIEQQSKLIEEKIMQKMEMTKEKRDS 218 >SB_1172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 29.5 bits (63), Expect = 1.3 Identities = 17/88 (19%), Positives = 43/88 (48%), Gaps = 2/88 (2%) Query: 40 QLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRR 99 ++ AAP K ++ ++ + ++QQ++Q++ + ++ Q + Q +++++ Sbjct: 27 RVTAAPSKTQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQKQQQQQQQQQQQQQQ 86 Query: 100 REHLLQMNQILAKQVTEMSKIIAVKAWE 127 R+ Q N K+ SK +AW+ Sbjct: 87 RQQQQQQNGSFTKR--NDSKYEYREAWK 112 >SB_57079| Best HMM Match : DUF1140 (HMM E-Value=3.8) Length = 235 Score = 29.1 bits (62), Expect = 1.8 Identities = 20/91 (21%), Positives = 46/91 (50%), Gaps = 4/91 (4%) Query: 27 PPRDLRRADNTIDQLLA-APQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTS 85 P R R+ + I+ L A + + E+ + K E+ ++ Q +Q+ E ++ M+ Sbjct: 124 PKRQRRKGGDAIEFLKERADKNSELREKELNMKK-EMQQQQLQLQQKNTEMMQAMVQQQQ 182 Query: 86 ADQSKSPQPEEKRRREHLLQMNQILAKQVTE 116 Q + QP++++ ++ LQ Q+ +Q+ + Sbjct: 183 QQQQQ--QPQQQQPQQQQLQQQQLQQQQLQQ 211 Score = 28.7 bits (61), Expect = 2.3 Identities = 11/55 (20%), Positives = 29/55 (52%) Query: 67 QQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKII 121 QQK E ++++ + Q + QP++++ ++ LQ Q+ +Q+ + ++ Sbjct: 167 QQKNTEMMQAMVQQQQQQQQQQPQQQQPQQQQLQQQQLQQQQLQQQQLQQQQMLM 221 >SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) Length = 1421 Score = 29.1 bits (62), Expect = 1.8 Identities = 13/75 (17%), Positives = 40/75 (53%) Query: 42 LAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRRE 101 + APQ+ ++ ++ + ++QQ++Q++ + ++ Q + Q +++++++ Sbjct: 125 ILAPQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 184 Query: 102 HLLQMNQILAKQVTE 116 LL +N+ L + E Sbjct: 185 QLLLLNEDLRQPKLE 199 Score = 29.1 bits (62), Expect = 1.8 Identities = 17/58 (29%), Positives = 31/58 (53%) Query: 52 ERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQI 109 +R + E+ + EE ++ QE+ E ++M A + K + EE+RRR+ Q+ I Sbjct: 1251 QRRLEEEQIREAEEELRRLQEEREYREQMRKIAEARERKLQEEEEERRRQEEEQLRAI 1308 Score = 27.9 bits (59), Expect = 4.1 Identities = 11/52 (21%), Positives = 29/52 (55%) Query: 57 EKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQ 108 EK L+P++QQ++Q++ + ++ Q + Q +++++++ Q Q Sbjct: 121 EKTNILAPQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 172 Score = 27.1 bits (57), Expect = 7.1 Identities = 24/103 (23%), Positives = 43/103 (41%), Gaps = 4/103 (3%) Query: 39 DQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEK--VESIKKMLTSTSADQSKSPQPEE 96 +Q LA Q + EK L E+Q +R+E+ E +K ++ E Sbjct: 1117 EQALARAQAEAKQQAIEEEKAKRLQDEDQARREEEQAQEKLKDAKRKAREERESRRAAEA 1176 Query: 97 KRRREHLLQMNQILAKQVTEMSKIIAVKAWEELPLNQSDHEAE 139 +RRR + + + K+ EM + K E+ ++Q + E Sbjct: 1177 ERRRLEVQKKREEKKKREEEMRE--KEKEMEQNKIDQEKRKQE 1217 >SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2520 Score = 29.1 bits (62), Expect = 1.8 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 6/54 (11%) Query: 71 QEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQM------NQILAKQVTEMS 118 +EKV+S++K L TS + + EKR E L++ NQ + K++ E+S Sbjct: 1648 REKVQSLEKELMETSEKLREDLRGSEKREEELKLKLEAGESNNQAIDKKIAELS 1701 Score = 28.7 bits (61), Expect = 2.3 Identities = 16/60 (26%), Positives = 35/60 (58%), Gaps = 4/60 (6%) Query: 61 ELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKI 120 EL+ E Q+ ++EK+ + +K L A+ EK+ EH+ + N+ +++ +E++K+ Sbjct: 680 ELTSEVQKYKEEKLMAEEKHL----AEAQSIKVEYEKKVEEHIKEKNEAISQLQSEITKV 735 Score = 27.1 bits (57), Expect = 7.1 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 1/80 (1%) Query: 61 ELSPEEQQKRQEKVESIKKM-LTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSK 119 E + EE +K++E E K+ + + A+ + EEK RR + +M + A+ V M K Sbjct: 177 EKALEESEKKREIAELKKEREIEAMKAEFDAASSAEEKDRRMLVDEMRKDKAEVVALMQK 236 Query: 120 IIAVKAWEELPLNQSDHEAE 139 I+ EL + E E Sbjct: 237 EISAAKDSELEKALAKKEKE 256 >SB_49353| Best HMM Match : AfsA (HMM E-Value=5.5) Length = 222 Score = 29.1 bits (62), Expect = 1.8 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 3/56 (5%) Query: 50 IPERYIPEKPPELSPEEQQKRQEKVES---IKKMLTSTSADQSKSPQPEEKRRREH 102 IP+R+ P ELSPE+ KR ++ +S T + + E RRR H Sbjct: 107 IPQRHRNRTPAELSPEKPGKRLDRTQSEHVFPNYRTPGEDSFALGKRAHELRRRTH 162 >SB_45203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 668 Score = 29.1 bits (62), Expect = 1.8 Identities = 22/102 (21%), Positives = 43/102 (42%), Gaps = 5/102 (4%) Query: 50 IPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSAD---QSKSPQPEEKRRREHLLQM 106 +P+ +P SP + + + M+TS + ++S +P+ +R EH Q+ Sbjct: 128 LPDSEYALEPRTDSPSTRNLKTSHIWPFPAMVTSEAGRICIPNRSSEPQLLKRNEHFCQI 187 Query: 107 NQILAKQVTEMSKIIAVKAWEELPLNQSDHEAEDRSPDVELP 148 N++ V + + + E + S +D PD LP Sbjct: 188 NEVFTPTVEQFQQQSPIPPAETSNVRHSAKVRKD--PDNFLP 227 >SB_41311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 753 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/31 (38%), Positives = 20/31 (64%) Query: 58 KPPELSPEEQQKRQEKVESIKKMLTSTSADQ 88 KPP + +K Q+ V+ IKK++TS ++ Q Sbjct: 160 KPPSMKDYWSEKHQKAVDDIKKLITSPASLQ 190 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 29.1 bits (62), Expect = 1.8 Identities = 28/109 (25%), Positives = 52/109 (47%), Gaps = 8/109 (7%) Query: 52 ERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQ-PEEKR---RREHLLQMN 107 E+ + EKP E ++K+ EKV+ K+ T A + EEK E +++ Sbjct: 5125 EKVVEEKPLEKPIARKEKKVEKVKPKKEKPTEREAKPLEEKHLVEEKELPVSAEKVVE-E 5183 Query: 108 QILAKQVT-EMSKIIAVKAWEELPLNQSDHEAEDRS--PDVELPIYQQR 153 + L K +T + K+ VK +E P+ + E++ + ELP+ ++ Sbjct: 5184 KPLEKPITRKEDKVEEVKPKKEKPMEREAQHLEEKPLLKEKELPVSAEK 5232 >SB_7444| Best HMM Match : Transposase_1 (HMM E-Value=9.4) Length = 167 Score = 29.1 bits (62), Expect = 1.8 Identities = 20/91 (21%), Positives = 46/91 (50%), Gaps = 4/91 (4%) Query: 27 PPRDLRRADNTIDQLLA-APQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTS 85 P R R+ + I+ L A + + E+ + K E+ ++ Q +Q+ E ++ M+ Sbjct: 56 PKRQRRKGGDAIEFLKERADKNSELREKELNMKK-EMQQQQLQLQQKNTEMMQAMVQQQQ 114 Query: 86 ADQSKSPQPEEKRRREHLLQMNQILAKQVTE 116 Q + QP++++ ++ LQ Q+ +Q+ + Sbjct: 115 QQQQQ--QPQQQQPQQQQLQQQQLQQQQLQQ 143 Score = 28.7 bits (61), Expect = 2.3 Identities = 11/55 (20%), Positives = 29/55 (52%) Query: 67 QQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKII 121 QQK E ++++ + Q + QP++++ ++ LQ Q+ +Q+ + ++ Sbjct: 99 QQKNTEMMQAMVQQQQQQQQQQPQQQQPQQQQLQQQQLQQQQLQQQQLQQQQMLM 153 >SB_3581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 29.1 bits (62), Expect = 1.8 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Query: 13 ALRGAAPDVVRSALPPRDLRRADNTIDQLLAAPQKIVIPERYIPE 57 AL AP+ V P D+ R D +LL +++V PE Y PE Sbjct: 407 ALDRDAPEEVNDLTVP-DVERIDRRAGELLQEFKELVYPENYDPE 450 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 29.1 bits (62), Expect = 1.8 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 5/85 (5%) Query: 62 LSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKII 121 L E +++ QE++ S+K+ L + KS + K+R + L Q ++L+ E SK+ Sbjct: 882 LKSELEKQHQEELVSLKEYLEEKHQAEIKSIDGDFKQRMQSLSQ--ELLS--TDEQSKVD 937 Query: 122 AVKAWEELPLNQSDHEAEDRSPDVE 146 ++A+ E + D E ++ D+E Sbjct: 938 VIQAYLENKF-KDDLEQYKKNVDIE 961 Score = 26.6 bits (56), Expect = 9.4 Identities = 17/82 (20%), Positives = 41/82 (50%), Gaps = 5/82 (6%) Query: 48 IVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRR-----EH 102 +++ E Y PPE + Q QE+++ +++ L + Q +S Q ++ ++ + Sbjct: 2070 VLVVENYETGFPPEGEDIQVQALQERIKELEETLDAFKQAQEESIQESDEVKKLLRLVDQ 2129 Query: 103 LLQMNQILAKQVTEMSKIIAVK 124 + + LA +V E+ + + V+ Sbjct: 2130 VSTEKEDLANRVKELQERLGVE 2151 >SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 29.1 bits (62), Expect = 1.8 Identities = 13/45 (28%), Positives = 25/45 (55%) Query: 57 EKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRRE 101 E+ E EE+++ +EK E ++ ++ + + EEKRRR+ Sbjct: 221 EEEEEEEEEEEEEEEEKEEEEEEEEEEEEEEEEEEEEEEEKRRRK 265 Score = 27.5 bits (58), Expect = 5.4 Identities = 14/61 (22%), Positives = 28/61 (45%) Query: 41 LLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRR 100 L A P +V E E+ E EE+++ +E+ E ++ ++ + + EE+ Sbjct: 186 LFAVPASVVEEEEEEEEEEVEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEKEEEEEEEE 245 Query: 101 E 101 E Sbjct: 246 E 246 >SB_10877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 530 Score = 29.1 bits (62), Expect = 1.8 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 3/41 (7%) Query: 57 EKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEK 97 +K LSPE + +KVE + ++T SA Q+ SP+PE+K Sbjct: 273 KKQGSLSPELTES--QKVEQSQDLVTQ-SAKQADSPKPEQK 310 >SB_59689| Best HMM Match : Pkinase (HMM E-Value=0.007) Length = 881 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/63 (23%), Positives = 31/63 (49%) Query: 57 EKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTE 116 EKPP+ E+QK++E+ + ++ + + +K +RE N+ K + E Sbjct: 626 EKPPQKITSEEQKQKERNRQKHREEMERKREKLQKERELKKAKREKERDENEKARKTLLE 685 Query: 117 MSK 119 ++K Sbjct: 686 LAK 688 Score = 28.3 bits (60), Expect = 3.1 Identities = 26/109 (23%), Positives = 48/109 (44%), Gaps = 4/109 (3%) Query: 45 PQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHL- 103 PQKI E+ E+ + EE ++++EK++ +++ A + K EK R+ L Sbjct: 629 PQKITSEEQKQKERNRQKHREEMERKREKLQKEREL---KKAKREKERDENEKARKTLLE 685 Query: 104 LQMNQILAKQVTEMSKIIAVKAWEELPLNQSDHEAEDRSPDVELPIYQQ 152 L Q L V E I ++ + + E + P+ E + Q+ Sbjct: 686 LAKEQALEIVVPEHEVISKEDELDDDFEDWDEFETAEPEPEPEPSVKQK 734 >SB_33494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1097 Score = 28.7 bits (61), Expect = 2.3 Identities = 23/95 (24%), Positives = 39/95 (41%), Gaps = 5/95 (5%) Query: 58 KPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHL----LQMNQILAKQ 113 K E EE++K +E+ E + +S ++SK P+P + HL ++ L + Sbjct: 643 KSGEEEREEEEKEKEEEEQVTPEEPRSSEEESK-PKPGRPKGTHHLRLVTTAVSPFLKSR 701 Query: 114 VTEMSKIIAVKAWEELPLNQSDHEAEDRSPDVELP 148 + IA + E P +DR E P Sbjct: 702 AKKQPSPIAEEPSPETPRKPEPEVTQDRDESDEEP 736 >SB_26060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2671 Score = 28.7 bits (61), Expect = 2.3 Identities = 24/123 (19%), Positives = 45/123 (36%), Gaps = 1/123 (0%) Query: 32 RRADNTIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKS 91 R +D L P ++ R + E +KR++K E +K T + D K Sbjct: 2177 RDVGKEVDTPLYEPLDVLTSSRDFTSAETGVDIEPSKKRKKKKEGLKDDQT-VARDAGKE 2235 Query: 92 PQPEEKRRREHLLQMNQILAKQVTEMSKIIAVKAWEELPLNQSDHEAEDRSPDVELPIYQ 151 R+ L + ++ + + ++ L A D +V+ P+Y+ Sbjct: 2236 VDTPVYESRDVLTSSRDFTSAEIGLDIEPSKKRKKKKEGLKDDQTVARDAGKEVDTPVYE 2295 Query: 152 QRD 154 RD Sbjct: 2296 SRD 2298 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 28.7 bits (61), Expect = 2.3 Identities = 19/79 (24%), Positives = 35/79 (44%), Gaps = 2/79 (2%) Query: 65 EEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIAVK 124 EE++K+ E ES A + + +E+ RRE L + + K+ E K++ Sbjct: 509 EEEEKKTE--ESYDDSWRGRRARRKAEEERKERERRERLEKKHSEPEKKTEEPPKVVVEP 566 Query: 125 AWEELPLNQSDHEAEDRSP 143 E+ P + + E + P Sbjct: 567 TVEKEPAVKVESEKTEEEP 585 Score = 27.1 bits (57), Expect = 7.1 Identities = 12/45 (26%), Positives = 25/45 (55%) Query: 57 EKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRRE 101 E+ + EE+++R+E+ E ++ ++ K + EEK+R E Sbjct: 434 ERKKREAEEEEERRREEEERREEEERKREEEERKQREEEEKKREE 478 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 28.7 bits (61), Expect = 2.3 Identities = 29/121 (23%), Positives = 52/121 (42%), Gaps = 10/121 (8%) Query: 23 RSALPPRDLRRADNTIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLT 82 +++ P D + DN +L K I + + E +E+++RQ+++E KK Sbjct: 880 KTSTVPSDKEKKDNEKARLKEMKDKEKIEKEKREKDKREREEKERKRRQQQLEKEKK--- 936 Query: 83 STSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIAVKAWEELPLNQSD--HEAED 140 + + EK +RE Q ++ K+ E K E+ L Q D HE E+ Sbjct: 937 -----EKEKKLLIEKEKREKEKQKERLREKEEKEKQKEAERAKKEKERLLQEDKLHEKEE 991 Query: 141 R 141 + Sbjct: 992 K 992 Score = 27.9 bits (59), Expect = 4.1 Identities = 17/79 (21%), Positives = 40/79 (50%), Gaps = 4/79 (5%) Query: 61 ELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKI 120 E +++Q +EK +S+K++ +D+ + + +E+ ++ + + +VTE+ + Sbjct: 1005 EKREKDKQVEKEKKDSLKRVKKRKDSDKERKVKEKEEEQKVKI----EKEPNKVTEVQLM 1060 Query: 121 IAVKAWEELPLNQSDHEAE 139 + EE P D E+E Sbjct: 1061 VEETNKEESPSTDRDAESE 1079 >SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1068 Score = 28.7 bits (61), Expect = 2.3 Identities = 13/48 (27%), Positives = 25/48 (52%) Query: 56 PEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHL 103 P K PE P+E+ K+ E + K T +A++ P+E+ + + + Sbjct: 1018 PTKKPEPPPKEEDKKTEDAGAKKDGETVENAEKMDDEAPQEQNKPQDM 1065 >SB_11869| Best HMM Match : Excalibur (HMM E-Value=8) Length = 269 Score = 28.7 bits (61), Expect = 2.3 Identities = 19/92 (20%), Positives = 38/92 (41%), Gaps = 2/92 (2%) Query: 51 PERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQIL 110 P + P K SP ++ ++ + S D++ +P+ EE+ ++ ++ Sbjct: 105 PAKEEPAKEEAASPSDETTTDSPWDASAPTEEAPSRDEAAAPKQEEEAPKDEAAASEEVA 164 Query: 111 AKQVTEMSKIIAVKAWEELPLNQSDHEAEDRS 142 A TE + +N++D AED S Sbjct: 165 A--ATEGTSAATETNDASAEVNETDKSAEDAS 194 >SB_4588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 729 Score = 28.7 bits (61), Expect = 2.3 Identities = 13/44 (29%), Positives = 24/44 (54%) Query: 65 EEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQ 108 E ++R+E+ E +++ L + AD+ + E RRRE + Q Sbjct: 59 EAARRRRERREQMRRELEESKADEDDAAARREARRREREARRKQ 102 >SB_39156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 28.7 bits (61), Expect = 2.3 Identities = 16/62 (25%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Query: 66 EQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIAVKA 125 E+ KR+ K E+I++M + Q + E++ +RE N ++ + SK+ +V Sbjct: 133 ERLKRRAKSEAIRRMRKQSKMQQEREKAYEKRVQRETKNGKNSAEMNEL-KASKVYSVSD 191 Query: 126 WE 127 W+ Sbjct: 192 WD 193 >SB_26950| Best HMM Match : TBC (HMM E-Value=5.2e-28) Length = 998 Score = 28.7 bits (61), Expect = 2.3 Identities = 18/76 (23%), Positives = 33/76 (43%), Gaps = 2/76 (2%) Query: 27 PPRDLRRADNTIDQLLAAPQKIVIP--ERYIPEKPPELSPEEQQKRQEKVESIKKMLTST 84 P RR +T+D + +P + P E IP++ + P QQ+ + + L Sbjct: 349 PSPATRRRSHTLDTITTSPTPSLTPIGEAVIPQRVLDSMPVHQQRMLQAQSLAQARLPRN 408 Query: 85 SADQSKSPQPEEKRRR 100 + +S + Q + R R Sbjct: 409 KSSESLTVQTKFSRNR 424 >SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4700 Score = 28.7 bits (61), Expect = 2.3 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 5/102 (4%) Query: 39 DQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKM-LTSTSADQSKSPQPEEK 97 + +L A + E +PE PP L + Q +E ++M S SA + P+ K Sbjct: 1615 NHVLTAEEIEAHTEEGVPESPPTLEQFKDQSNREICAMEEEMNALSESAGLFEVNFPDYK 1674 Query: 98 RRREHLLQMNQILAKQVTEMSKII--AVKAWEELPLNQSDHE 137 + R + IL KQ+ +M ++ +++ W+ P + D E Sbjct: 1675 QLR--ACRREVILLKQLWDMIFVVLTSIEEWKFTPWAEIDVE 1714 >SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) Length = 317 Score = 28.7 bits (61), Expect = 2.3 Identities = 22/92 (23%), Positives = 42/92 (45%), Gaps = 1/92 (1%) Query: 11 ERALRGAAPDVVRSALPPRDLRRADNTIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKR 70 E AL+ A +++ R L R+ +LLA ++ + E+ I + + EE+++R Sbjct: 178 EEALKKAEEEMMLQEHKQRGLERSKQEAQRLLALQEQHLKEEQEIKNEVEKERQEEEKRR 237 Query: 71 QEKVESIKKMLTSTSADQSKSPQPEEKRRREH 102 E +E + +SK + EE + H Sbjct: 238 ME-IEKQRMESEKKRILESKQKRIEESKDTIH 268 >SB_1091| Best HMM Match : Cupin_4 (HMM E-Value=0) Length = 584 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/47 (31%), Positives = 25/47 (53%) Query: 58 KPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLL 104 K E S EE++K +E+ +S KK T + + + EE+ E+ L Sbjct: 492 KKKEESEEEEEKSEEEKKSKKKTKTKKGKKEKQESESEEESDAEYEL 538 >SB_59712| Best HMM Match : SAP (HMM E-Value=3e-13) Length = 1072 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/36 (30%), Positives = 19/36 (52%) Query: 63 SPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKR 98 +P+E K E K +S ++SP+PEE++ Sbjct: 442 APQEDDKSSSATEEYKSEPSSAQPSANQSPEPEEEK 477 >SB_52732| Best HMM Match : M (HMM E-Value=0.019) Length = 1366 Score = 28.3 bits (60), Expect = 3.1 Identities = 26/112 (23%), Positives = 51/112 (45%), Gaps = 6/112 (5%) Query: 47 KIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQM 106 K++ E+Y E+ ++ +E++ Q +VE +++ML + Q K + EE E Q Sbjct: 648 KLLEDEKYGLERRLDILVKERKNLQGRVEELEEMLEAEREKQHK--KNEEISSDEDAEQA 705 Query: 107 NQILAK----QVTEMSKIIAVKAWEELPLNQSDHEAEDRSPDVELPIYQQRD 154 Q L + + E+ + + + Q+ EAE D + + QQ + Sbjct: 706 RQALEETMHTTIEELHEEVETLRSRLQDVGQAKLEAEKLVQDTQATVQQQSE 757 >SB_49862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 28.3 bits (60), Expect = 3.1 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 4/82 (4%) Query: 55 IPEKPPELSPEEQQKRQEKVESIKKMLTSTS---ADQSKSPQPEEKRRREHLLQMNQILA 111 I EK L EE + +K++ + ML S ADQ + Q E + E++ ++ + L Sbjct: 439 IEEKYASLQ-EEASGKTKKLKKVWTMLMSAKSEMADQQQEHQRETEGLLENIRELRRELQ 497 Query: 112 KQVTEMSKIIAVKAWEELPLNQ 133 +QV + I V+ E + N+ Sbjct: 498 RQVLIIDSFIPVEFQELVEQNK 519 >SB_31639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 28.3 bits (60), Expect = 3.1 Identities = 8/46 (17%), Positives = 29/46 (63%) Query: 56 PEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRRE 101 P++ + P++QQ++Q + + +T+++ + + Q ++K++++ Sbjct: 180 PQQQQQQQPQQQQQQQPQQQQATTTTATTTSNNNNNKQQQQKKQQQ 225 Score = 26.6 bits (56), Expect = 9.4 Identities = 12/65 (18%), Positives = 35/65 (53%) Query: 51 PERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQIL 110 P++ ++ + P++QQ++Q + ++ T+TS + + + + +++ +++ Q Q Sbjct: 32 PQQQQQQQQQQQQPQQQQQQQPQQQATTTTTTTTSNNSNHNNKQQQQPQQQQQQQPQQQQ 91 Query: 111 AKQVT 115 A T Sbjct: 92 ATTTT 96 >SB_26577| Best HMM Match : Vicilin_N (HMM E-Value=1.5) Length = 649 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/90 (17%), Positives = 44/90 (48%), Gaps = 1/90 (1%) Query: 65 EEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIAVK 124 E+++++QE+++ + L S + K Q + +RR+E +M + ++ + + K Sbjct: 379 EQEKQKQEQIKKNQMQLKRLSEAEKKRQQEQNRRRKEREEEMTRNMS-YLNLLDKHERAS 437 Query: 125 AWEELPLNQSDHEAEDRSPDVELPIYQQRD 154 L Q + + R+ + ++ + + +D Sbjct: 438 RVRNRQLTQEQMKLKLRNEEEKMKVSEMKD 467 >SB_22299| Best HMM Match : Protamine_P2 (HMM E-Value=2.4) Length = 488 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/42 (30%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Query: 58 KPPELSPEEQQKRQEKVESIKKMLTSTS-ADQSKSPQPEEKR 98 KP + + +++Q +Q+K ES K T S ++ PQ ++K+ Sbjct: 397 KPQDRAKQDKQDKQDKQESSKTSKTKPSKTSKTSKPQDQDKQ 438 >SB_18951| Best HMM Match : EGF (HMM E-Value=2.1e-06) Length = 1223 Score = 28.3 bits (60), Expect = 3.1 Identities = 17/82 (20%), Positives = 43/82 (52%), Gaps = 3/82 (3%) Query: 41 LLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRR 100 LL QK V E+ +K + +EQ++RQ++++ ++ L D + + ++++ Sbjct: 227 LLEEKQKTVTEEQ---QKLIQAQIDEQRERQKRLQEEQERLQEKQEDFLRKQKEQQEQLL 283 Query: 101 EHLLQMNQILAKQVTEMSKIIA 122 + +Q L Q ++++++A Sbjct: 284 QQQFNQSQTLQLQQQQLAQMLA 305 >SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/89 (14%), Positives = 43/89 (48%) Query: 65 EEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIAVK 124 +E+QK++E+ E ++ ++ K + EE+++ Q ++ +Q E+ + + Sbjct: 92 QEEQKQEEQEEQKQEEQKQEVQEEQKQEEQEEQKQEVQEEQKQEVQEEQKQEVQEEQKQE 151 Query: 125 AWEELPLNQSDHEAEDRSPDVELPIYQQR 153 EE + + + ++ + + + +++ Sbjct: 152 VQEEQKQEEQEEQKQEEQEEQKQEVQEEQ 180 Score = 27.9 bits (59), Expect = 4.1 Identities = 16/99 (16%), Positives = 44/99 (44%) Query: 46 QKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQ 105 QK+ ++ +K + +E+QK++ + E ++ ++ K EE+++ E Q Sbjct: 65 QKVQEEQKQEVQKEQKQEEQEEQKQEVQEEQKQEEQEEQKQEEQKQEVQEEQKQEEQEEQ 124 Query: 106 MNQILAKQVTEMSKIIAVKAWEELPLNQSDHEAEDRSPD 144 ++ +Q E+ + + EE + + ++ + Sbjct: 125 KQEVQEEQKQEVQEEQKQEVQEEQKQEVQEEQKQEEQEE 163 Score = 27.5 bits (58), Expect = 5.4 Identities = 16/91 (17%), Positives = 44/91 (48%), Gaps = 1/91 (1%) Query: 57 EKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTE 116 +K + +E+QK++E+ + +++ ++ K EE++++ Q ++ +Q E Sbjct: 23 QKEQKQEVQEEQKQEEQKQEVQEEQKQEVQEEQKQEVQEEQKQKVQEEQKQEVQKEQKQE 82 Query: 117 MSKIIAVKAWEELPL-NQSDHEAEDRSPDVE 146 + + EE Q + + E++ +V+ Sbjct: 83 EQEEQKQEVQEEQKQEEQEEQKQEEQKQEVQ 113 >SB_52883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1434 Score = 28.3 bits (60), Expect = 3.1 Identities = 18/94 (19%), Positives = 44/94 (46%), Gaps = 1/94 (1%) Query: 60 PELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMS- 118 PE Q+K QEK +S + + +S+ + ++ + Q + +Q+ E S Sbjct: 1044 PESKDSTQEKTQEKDQSQQAPEQAQETQESQEESVKPTQQELAVQQATPLNQQQIQESST 1103 Query: 119 KIIAVKAWEELPLNQSDHEAEDRSPDVELPIYQQ 152 +++ + +E P+ Q+ + + + ++ P Q+ Sbjct: 1104 QVLEKQQSQEQPVKQTQQKTDVQQATLQEPQRQE 1137 >SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2839 Score = 28.3 bits (60), Expect = 3.1 Identities = 33/129 (25%), Positives = 58/129 (44%), Gaps = 16/129 (12%) Query: 3 RSVDDADMERALRGAAPDVVRSALPPRDLRRADNTI--DQLLAAPQKIVIPERYIPEKPP 60 R +D + + R A P + PPR + + + D+ + + I I R+ E P Sbjct: 2289 RKLDLSQFSKFQRAAEPTPQK---PPRKISQKETPPKEDRQVLETEIITIETRHEVESAP 2345 Query: 61 ELSPEE----QQKRQEKV---ESIKKMLTSTSADQSKSPQPEEKR---RREHLLQMNQIL 110 + PE +++R+E + E IKK + + + EE+R RR LL+ Q L Sbjct: 2346 PVGPESIDMIEKEREEALSYDEKIKKEVKPLDVQKIIKQRQEEQRESQRRARLLE-EQRL 2404 Query: 111 AKQVTEMSK 119 ++ EM + Sbjct: 2405 REEREEMER 2413 >SB_36987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 453 Score = 28.3 bits (60), Expect = 3.1 Identities = 14/46 (30%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Query: 57 EKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREH 102 E+ E EE+++R+E+ E + ++ + +Q KS E+KR ++H Sbjct: 366 EREEEERREEEERREEEGE--QHIVNNNLNEQQKSEGREQKRSKDH 409 >SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 28.3 bits (60), Expect = 3.1 Identities = 14/45 (31%), Positives = 24/45 (53%) Query: 57 EKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRRE 101 E E S + ++K +EK + +++ D+ K + EEKR RE Sbjct: 976 EVDAEESKKREKKDKEKEKRERELQRKKERDEQKRKKEEEKRERE 1020 Score = 27.1 bits (57), Expect = 7.1 Identities = 13/63 (20%), Positives = 33/63 (52%) Query: 58 KPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEM 117 K E +E++KR+ +++ K+ + + + EEK+R+E + + K++ ++ Sbjct: 983 KKREKKDKEKEKRERELQRKKERDEQKRKKEEEKREREEKKRKEEERKRREKADKELKKI 1042 Query: 118 SKI 120 K+ Sbjct: 1043 HKL 1045 Score = 26.6 bits (56), Expect = 9.4 Identities = 13/45 (28%), Positives = 23/45 (51%) Query: 57 EKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRRE 101 +K E E Q+++E+ E +K + K + EE++RRE Sbjct: 989 DKEKEKRERELQRKKERDEQKRKKEEEKREREEKKRKEEERKRRE 1033 >SB_10763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 260 Score = 28.3 bits (60), Expect = 3.1 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 4/72 (5%) Query: 56 PEKPPELSPEEQQKR---QEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQM-NQILA 111 P +P +P + K E+ + S+ + +K E KRR E+L Q +++LA Sbjct: 131 PSQPAAATPSDAAASWLSSAKAEAASESTGSSGSQGAKMSDEELKRRTEYLKQQRDKLLA 190 Query: 112 KQVTEMSKIIAV 123 + E +K +AV Sbjct: 191 LKQQERNKHLAV 202 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 28.3 bits (60), Expect = 3.1 Identities = 22/79 (27%), Positives = 44/79 (55%), Gaps = 6/79 (7%) Query: 70 RQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSK-IIAVKAWEE 128 ++EK+ +++K S ++KS EE+ E L++ N+IL ++ ++ K ++A+K E Sbjct: 1515 QREKL-NVEKNDLKVSLHKTKSHLAEEEMENEKLVKENEILKVELEQLKKEMMALKVEME 1573 Query: 129 ----LPLNQSDHEAEDRSP 143 P+ + EA + SP Sbjct: 1574 NMQMAPVQVATVEAVESSP 1592 >SB_55427| Best HMM Match : E-MAP-115 (HMM E-Value=0.077) Length = 599 Score = 27.9 bits (59), Expect = 4.1 Identities = 14/48 (29%), Positives = 26/48 (54%) Query: 57 EKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLL 104 EK E +E +++ IK + +T+A+ S+ E ++REH+L Sbjct: 330 EKTLEERLKEVDSLNNQLKEIKTSVQNTTAENSRLQHMAEAKQREHVL 377 >SB_34146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 27.9 bits (59), Expect = 4.1 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 5/49 (10%) Query: 29 RDLRRADNTIDQLLAAPQKIVIPERYIPEK--PPELSPEEQQKRQEKVE 75 R +R NT +L+ P +P P+K PPE SP E KR+EK+E Sbjct: 36 RRIRPPRNTKRAILSQPH-FAMPPASPPKKSPPPEKSPAE--KRKEKLE 81 >SB_30139| Best HMM Match : E-MAP-115 (HMM E-Value=0.072) Length = 233 Score = 27.9 bits (59), Expect = 4.1 Identities = 14/48 (29%), Positives = 26/48 (54%) Query: 57 EKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLL 104 EK E +E +++ IK + +T+A+ S+ E ++REH+L Sbjct: 57 EKTLEERLKEVDSLNNQLKEIKTSVQNTTAENSRLQHMAEAKQREHVL 104 >SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1142 Score = 27.9 bits (59), Expect = 4.1 Identities = 13/50 (26%), Positives = 25/50 (50%) Query: 52 ERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRRE 101 E+ +PE E P+++++ + K E +K+ A K P+ E +E Sbjct: 518 EKQVPEIRVEPEPKDEKEEESKTEEKEKLEGEGQAIPEKEPKEGETMAKE 567 >SB_16838| Best HMM Match : TolA (HMM E-Value=2) Length = 371 Score = 27.9 bits (59), Expect = 4.1 Identities = 11/52 (21%), Positives = 28/52 (53%) Query: 57 EKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQ 108 +K + + QQ++Q++ + +K+ Q + QP+++R+++ Q Q Sbjct: 58 QKRQQQQQKRQQQKQKRQQQEQKLQQQQRRQQQQKRQPQQRRQQQQQRQPQQ 109 >SB_14492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 975 Score = 27.9 bits (59), Expect = 4.1 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 9/74 (12%) Query: 34 ADNTIDQLLAAPQK----IVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQS 89 A+ + + L+ P+K + + ERY P + + PE+ + R+E + +S S ++ Sbjct: 65 AEWIVKEHLSGPEKERLAVFLKERYKPSQETDSKPEKSETRRE-----SRAKSSHSKEKE 119 Query: 90 KSPQPEEKRRREHL 103 K + EEK L Sbjct: 120 KEIRKEEKSEATEL 133 >SB_47950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 27.9 bits (59), Expect = 4.1 Identities = 14/41 (34%), Positives = 21/41 (51%) Query: 61 ELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRRE 101 E+S E + E KK +S +D SKS + +KR R+ Sbjct: 243 EISDSESAENDENNSKKKKPKSSLGSDSSKSTKKAKKRERK 283 >SB_46305| Best HMM Match : SSDP (HMM E-Value=2) Length = 848 Score = 27.9 bits (59), Expect = 4.1 Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 18 APDVVRSALPPRDLRRADNTIDQLLAAPQKI 48 +PDV LP DL+ A+ T+DQ++ K+ Sbjct: 605 SPDVFGIKLPTGDLKEANETLDQIVQQRFKV 635 >SB_38433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.9 bits (59), Expect = 4.1 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Query: 57 EKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRRE 101 E+ P+L E +Q+ +E+ E KK + ++ + + EEKRR+E Sbjct: 36 ERFPDLRQEREQRDREEREEEKK----SQREKRQKEKEEEKRRKE 76 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 27.9 bits (59), Expect = 4.1 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 4/74 (5%) Query: 50 IPERYIPEKPPELSPEEQQKRQEKVESIK---KMLTSTSADQSKSPQPEEK-RRREHLLQ 105 IP + P K + +P EQ++ ++ E+ K + AD+S Q EE+ R +E L+ Sbjct: 901 IPRKGTPRKRNQTNPREQRRVRKVKETTKDDDNKENESLADESMLTQEEEEARAQERKLE 960 Query: 106 MNQILAKQVTEMSK 119 + + E+SK Sbjct: 961 RERRDKDYLEEISK 974 >SB_36388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1570 Score = 27.9 bits (59), Expect = 4.1 Identities = 25/120 (20%), Positives = 49/120 (40%), Gaps = 2/120 (1%) Query: 14 LRGAAPDVVRSALPPRDLRRADNTIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEK 73 L+ AP+ + LR + +L Q I + E PE P ++ R Sbjct: 769 LKTFAPEEKSGDAALKVLREVPEDEEDILVRLQAIGDEDEMFME--PEPQPIRRRGRANS 826 Query: 74 VESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIAVKAWEELPLNQ 133 V +I +TS +AD EE R +H++ + V+ ++ ++ + L +++ Sbjct: 827 VVTIGTTITSDTADTDCMTIMEEDREVDHMIGEEKAATGSVSILAALMLCGDFNRLDISR 886 >SB_23891| Best HMM Match : P60 (HMM E-Value=2.2) Length = 1167 Score = 27.9 bits (59), Expect = 4.1 Identities = 12/58 (20%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Query: 59 PPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTE 116 PP + PEE++ + +++ +K+ L + + EK+ +E ++ + QI +++ + Sbjct: 439 PPVIKPEEKEPQTRRIQELKQGLAEEPI--LEYIEEFEKKMQEEIVMIGQISLEEIQD 494 >SB_12397| Best HMM Match : Extensin_2 (HMM E-Value=0.14) Length = 659 Score = 27.9 bits (59), Expect = 4.1 Identities = 12/29 (41%), Positives = 18/29 (62%) Query: 40 QLLAAPQKIVIPERYIPEKPPELSPEEQQ 68 QLLA P ++ R + PP+LSP+ +Q Sbjct: 480 QLLAPPPRLSPKHRQLLATPPQLSPKHRQ 508 Score = 27.1 bits (57), Expect = 7.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Query: 40 QLLAAPQKIVIPERYIPEKPPELSPEEQQ 68 QLLA P ++ R + PP LSP+ +Q Sbjct: 494 QLLATPPQLSPKHRQLLAPPPRLSPKHRQ 522 >SB_4695| Best HMM Match : SAM_1 (HMM E-Value=0.012) Length = 1348 Score = 27.9 bits (59), Expect = 4.1 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 4/78 (5%) Query: 58 KPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPE--EKRRREHLLQMNQILAKQVT 115 KPP P + R+EK E ++ D S SP E E + +L+ +L V Sbjct: 654 KPPRQEPTPSKPREEKAEKSPGEYRLSALDAS-SPLDESAEWEKNGGILEDQDLLEIGVL 712 Query: 116 EMS-KIIAVKAWEELPLN 132 +MS + I ++A + LP++ Sbjct: 713 DMSNRKILLEAVKSLPVH 730 >SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) Length = 991 Score = 27.9 bits (59), Expect = 4.1 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 6/58 (10%) Query: 19 PD-VVRSALPPRDL--RRADNTIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEK 73 PD ++ +P +DL RR +D L +I Y PE PP L E++ +E+ Sbjct: 75 PDFIINLKIPDKDLEVRRLTQKLDPLTG---QIYTKAEYAPENPPPLLGEDEGGEEEE 129 >SB_58015| Best HMM Match : rve (HMM E-Value=0.00087) Length = 1333 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/31 (41%), Positives = 19/31 (61%) Query: 92 PQPEEKRRREHLLQMNQILAKQVTEMSKIIA 122 PQPE K+ + LL M L++ + MS+I A Sbjct: 520 PQPETKQDLQRLLGMVNYLSQYIPNMSEITA 550 >SB_53775| Best HMM Match : Involucrin2 (HMM E-Value=7.1e-12) Length = 1879 Score = 27.5 bits (58), Expect = 5.4 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 2/96 (2%) Query: 52 ERYIPEKPPELSPEEQQKRQEK-VESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQIL 110 E+ K P L E+QQ QE+ + S+K+ TS + S + + + E +L M Q Sbjct: 1711 EQQQTSKKPTLGVEQQQTSQEEPILSMKQQQTS-QEEPILSMEQHQTSQEEPILSMEQQQ 1769 Query: 111 AKQVTEMSKIIAVKAWEELPLNQSDHEAEDRSPDVE 146 + + + K L + Q E+ +P VE Sbjct: 1770 KESGLCVEQQQTSKEEPALGVEQQLTSKEESAPSVE 1805 >SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) Length = 665 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/52 (25%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Query: 49 VIPERYIPEKPPELS-PEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRR 99 + P+ ++ P E PE+ +K +EK E ++ PQP E+++ Sbjct: 265 LFPDNFVEILPEETDKPEKPEKMEEKSEKAVPPAPKQVEQRAPPPQPSEEKQ 316 >SB_49054| Best HMM Match : Chordopox_A30L (HMM E-Value=4.1) Length = 432 Score = 27.5 bits (58), Expect = 5.4 Identities = 23/91 (25%), Positives = 45/91 (49%), Gaps = 6/91 (6%) Query: 35 DNTIDQLLAAPQKIVIPERYIPE--KPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSP 92 ++T D L +I E+ + E K E + EE+ +Q SI ++L++ Q + P Sbjct: 222 EHTKDSKLDEEDRIRRREKELLETLKQEEEAVEEEDTKQSSKPSITRVLSNAEEVQDEDP 281 Query: 93 QPEEKRRREHLLQM----NQILAKQVTEMSK 119 + LLQ N++L+++ +++SK Sbjct: 282 AGYDYDEDFELLQAINAENEMLSREGSKLSK 312 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 27.5 bits (58), Expect = 5.4 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Query: 56 PEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRRE 101 P P+ SP + Q QEK++S++ ML TS+ + + EE+ R+ Sbjct: 2458 PPSRPKSSPSQSQ--QEKIDSVR-MLEPTSSSEHGAFTEEEECMRD 2500 >SB_13303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.5 bits (58), Expect = 5.4 Identities = 15/61 (24%), Positives = 30/61 (49%) Query: 61 ELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKI 120 +++PEE+ V +I + ++ AD+ P+ EEK E + +VT+ K+ Sbjct: 52 DVTPEEKAAASVNVTNIPESESAGKADEPVKPRQEEKEEYEEEETDTFDMEIKVTDPEKV 111 Query: 121 I 121 + Sbjct: 112 V 112 >SB_11112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 464 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/31 (41%), Positives = 19/31 (61%) Query: 55 IPEKPPELSPEEQQKRQEKVESIKKMLTSTS 85 +PE+ E P+EQ + +V+S K L STS Sbjct: 52 VPEEATEEDPDEQDQDFSRVQSETKPLRSTS 82 >SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 27.5 bits (58), Expect = 5.4 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Query: 40 QLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRR 99 QL QK + ER + E +QK +EK ++ L ++ + Q EEK+R Sbjct: 162 QLEVEKQKRLEEERIRSQNEERKRREREQKEREK----QQKLDMEKEERRRRQQEEEKKR 217 Query: 100 RE 101 RE Sbjct: 218 RE 219 >SB_56331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/52 (23%), Positives = 28/52 (53%) Query: 62 LSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQ 113 + E QQ++ + + +M+ + Q + QP++++ ++ LQ Q+L Q Sbjct: 1 MKKEMQQQQLQLQQKNTEMMQAMVQQQQQQQQPQQQQLQQQQLQQQQMLMMQ 52 >SB_53144| Best HMM Match : RVT_thumb (HMM E-Value=0.14) Length = 272 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/31 (41%), Positives = 19/31 (61%) Query: 92 PQPEEKRRREHLLQMNQILAKQVTEMSKIIA 122 PQPE K+ + LL M L++ + MS+I A Sbjct: 99 PQPETKQDLQRLLGMVNYLSQYIPNMSEITA 129 >SB_34223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 27.5 bits (58), Expect = 5.4 Identities = 15/55 (27%), Positives = 32/55 (58%), Gaps = 4/55 (7%) Query: 65 EEQQKRQEKVESIKKMLTSTSADQSKSP---QPEEKRRREHLLQMNQILAKQVTE 116 E+ + R+ ++SI+K + Q ++ PEEK++R++L ++ + KQ+ E Sbjct: 66 EKDEDRKRWIDSIRKSVEQNLQTQVRAALGTPPEEKKKRQYLKKVEE-ERKQINE 119 >SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1393 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/49 (24%), Positives = 30/49 (61%) Query: 65 EEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQ 113 +E+++R+++ E+I++ ++ + + EE+R++E L Q A+Q Sbjct: 1206 DEEERRRDEDEAIRRREEMRRREEDRIREEEERRKQEELKLRLQEEARQ 1254 >SB_10576| Best HMM Match : La (HMM E-Value=6.9e-28) Length = 711 Score = 27.5 bits (58), Expect = 5.4 Identities = 21/85 (24%), Positives = 36/85 (42%), Gaps = 2/85 (2%) Query: 57 EKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTE 116 EKP E Q + + + K T + KSP+P ++ + + + + KQ + Sbjct: 197 EKPAVPKAEGQDTKADLSKEEKNSKEQTPTPKIKSPEPPKEDEWKEVKRKKATIPKQAAQ 256 Query: 117 MSKIIAVKAWEELPLNQSDHEAEDR 141 S + EEL Q D E E++ Sbjct: 257 TSGFYNTEQ-EELDF-QFDEELENQ 279 >SB_864| Best HMM Match : Sulfotransfer_1 (HMM E-Value=6.4e-05) Length = 524 Score = 27.5 bits (58), Expect = 5.4 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 5/82 (6%) Query: 69 KRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIAVKA--- 125 KR+E E+ K T + PE+K++ + L+ + A +T+ +A KA Sbjct: 375 KRKEDTENQPKTKKDTESQPEMKVDPEKKKQSKTDLKAKKYDAFMITQRLATLASKASGQ 434 Query: 126 --WEELPLNQSDHEAEDRSPDV 145 WE L L + A R +V Sbjct: 435 AFWERLNLLRQIAGAWKRGEEV 456 >SB_53695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 387 Score = 27.1 bits (57), Expect = 7.1 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Query: 66 EQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIAVKA 125 E+Q R E + K +T + Q KRR H+++M Q L K++ ++ +A KA Sbjct: 193 ERQVRPENCANAKVARCNTGI--WRKLQEHTKRRDMHMVKMQQALVKEIIPVAH-VADKA 249 Query: 126 WEELPLN 132 LN Sbjct: 250 MVSKSLN 256 >SB_41786| Best HMM Match : AT_hook (HMM E-Value=0.24) Length = 324 Score = 27.1 bits (57), Expect = 7.1 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Query: 38 IDQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSA-DQSKSPQ 93 + ++ P K ER P + E E+Q+K+ +K S KK +A DQ+ +PQ Sbjct: 65 LGKVFPEPVKSAKKERK-PREKKEKPKEKQEKKPKKASSEKKEPEEVTAKDQAPTPQ 120 >SB_41092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 27.1 bits (57), Expect = 7.1 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Query: 47 KIVIPERYIP--EKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEK 97 K++ E Y P E PP LSP +++ + V +K + D +++ EE+ Sbjct: 253 KLLPVEEYFPGEELPPHLSPFVKEEEGDYVPPERKAIMDQEMDTNQNEVTEEE 305 >SB_31801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1018 Score = 27.1 bits (57), Expect = 7.1 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 3/72 (4%) Query: 8 ADMERALRGAAPDVVRSALPPRDLRRADNTIDQLLAAPQKIVIPE---RYIPEKPPELSP 64 A + RALR +RS + L D T DQ L Q + E R++ +KP L Sbjct: 137 AYLSRALRDQFVGGMRSQATRKKLLSEDRTFDQALKVAQADELAEKESRHLVDKPGLLEQ 196 Query: 65 EEQQKRQEKVES 76 E + +++ V S Sbjct: 197 EVRFVKKKPVGS 208 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 27.1 bits (57), Expect = 7.1 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 4/76 (5%) Query: 28 PRDLRRADNTIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESI--KKMLTSTS 85 P D +R D + + +K + + E+ + E ++K+QEK+E + KK Sbjct: 250 PTDEKRKDG--QEKVEEKEKGEVEDAQTTEEEEKQKEEAERKKQEKLEKLAKKKEELKER 307 Query: 86 ADQSKSPQPEEKRRRE 101 Q K Q +K+ +E Sbjct: 308 KRQEKLEQKAKKKEKE 323 >SB_24117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1276 Score = 27.1 bits (57), Expect = 7.1 Identities = 13/54 (24%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Query: 51 PERYIPEKPPELSP---EEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRRE 101 P+ +PE PE ++QQ++ E+ + ++ + + +Q P PE + E Sbjct: 748 PKSEVPEPDPEQQEAYLQQQQQQAEQQQQQQQNVAKSKVEQPPEPDPEAEGSAE 801 >SB_23319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 27.1 bits (57), Expect = 7.1 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Query: 61 ELSPEEQQKR--QEKVESIKKMLTSTSADQSKSPQPEEKRRRE 101 ++ EEQ+KR +E E+ KK+ SA +S +PE K+ ++ Sbjct: 89 KVEQEEQKKRMARELEEAKKKVAKEKSAKPKESKKPETKKPKK 131 >SB_1181| Best HMM Match : DUF1604 (HMM E-Value=0) Length = 1035 Score = 27.1 bits (57), Expect = 7.1 Identities = 14/44 (31%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Query: 58 KPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRRE 101 K E +E+++R+EK +S +K S S+ K+ + E+K+R++ Sbjct: 885 KRKEKKRKEKKRRREK-DSSEKTRVSKSSKNFKAAESEKKKRKK 927 >SB_58058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 27.1 bits (57), Expect = 7.1 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query: 56 PEKP--PELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQ 105 P KP P ++QQ++Q++ + K +A QPE++ R L++ Sbjct: 317 PAKPAMPTTHKQQQQQQQQQEKQPSKKAPEITAQDGPVHQPEQRTRSGRLVK 368 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 27.1 bits (57), Expect = 7.1 Identities = 23/116 (19%), Positives = 51/116 (43%), Gaps = 4/116 (3%) Query: 3 RSVDDADMERALRGAAPDVVRSALPPRDLRRADNTIDQLLA---APQKIVIPERYIPEKP 59 R + + ER R + R LRR +QL+ A + + P + + Sbjct: 504 RRKETEERERQAREEEDRIRREREEAERLRREKEQREQLVPHSDALECAIKPLNLLEARI 563 Query: 60 PELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRRE-HLLQMNQILAKQV 114 EE+Q+ E++++ ++ ++ + + EEK +RE L++ + A+++ Sbjct: 564 KAQKLEEEQRELERLQAEAELKRKQELERLREKRKEEKAQRERELIEQEKNRAREI 619 >SB_53565| Best HMM Match : Amino_oxidase (HMM E-Value=9.7e-19) Length = 438 Score = 27.1 bits (57), Expect = 7.1 Identities = 15/75 (20%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Query: 57 EKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTE 116 E+ E EE+++ +E+ E K ++ + + EE+ E +L +I ++ Sbjct: 39 EEEEEEEEEEEEEEEEEEEEEDKEEEEEEEEEEEEEEEEEEEEEEEVLLKTKIWQSRIAV 98 Query: 117 M-SKIIAVKAWEELP 130 ++ VK ++ P Sbjct: 99 FGGRVRTVKPFKGFP 113 >SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) Length = 2478 Score = 27.1 bits (57), Expect = 7.1 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Query: 66 EQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKI 120 +QQK Q ++E+IK TS +K E +MN+ + K + ++ +I Sbjct: 1332 DQQKAQSQMEAIKSQSTSVEGKNQAEVDALKKSLEEKTEEMNEKI-KTLNQVKRI 1385 >SB_47113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1286 Score = 27.1 bits (57), Expect = 7.1 Identities = 14/61 (22%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Query: 44 APQKIVIPERYIPEK----PPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRR 99 A +K+ +PE +K PP+ + EE+ ++ +++ T + + P EE + Sbjct: 566 AQKKVPVPEGLDLDKWINEPPKETSEEEDNAEDMFAGVEEQSYKTQVRKEQEPDEEELEK 625 Query: 100 R 100 R Sbjct: 626 R 626 >SB_31312| Best HMM Match : DUF740 (HMM E-Value=1.4) Length = 1209 Score = 27.1 bits (57), Expect = 7.1 Identities = 12/19 (63%), Positives = 15/19 (78%) Query: 60 PELSPEEQQKRQEKVESIK 78 PE+S EEQ KR +K ESI+ Sbjct: 820 PEMSSEEQWKRAKKGESIR 838 >SB_24031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1176 Score = 27.1 bits (57), Expect = 7.1 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 4/58 (6%) Query: 60 PELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEM 117 P ++Q RQ+K + + + SA +++ PQ + +++REH LQ NQ L T+M Sbjct: 566 PLQQQQQQLPRQQKQQ--QPLQQQQSAPETRPPQ-QPQQQREHYLQ-NQSLNVTNTQM 619 >SB_621| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1432 Score = 27.1 bits (57), Expect = 7.1 Identities = 15/63 (23%), Positives = 31/63 (49%) Query: 42 LAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRRE 101 +A P+K P R + E EE++K +EK+ +K+ L + ++ + ++ + Sbjct: 1090 VAEPKKKGKPGRKKKQPHTEEYKEEKEKCKEKMRPVKRALKMLESPENSASVKDQVAQTR 1149 Query: 102 HLL 104 H L Sbjct: 1150 HCL 1152 >SB_59580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 999 Score = 26.6 bits (56), Expect = 9.4 Identities = 24/105 (22%), Positives = 49/105 (46%), Gaps = 3/105 (2%) Query: 52 ERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILA 111 ++ + +K E +E++ R+EK L S +Q K +EK+ R + + Sbjct: 769 KKELTKKQLEKQKQEEKAREEKERKQSAKLAFQSWNQQKEETLKEKQERLKAKKKEE-EE 827 Query: 112 KQVTEMSKIIAVKAWEELPLNQSDHEAED--RSPDVELPIYQQRD 154 K++ + SK K + E ++ D E ++ R+ EL +Q++ Sbjct: 828 KELEKRSKTKDAKKYFESWKSKKDEELKEAHRAKMQELKKQKQKE 872 >SB_58624| Best HMM Match : E-MAP-115 (HMM E-Value=0.24) Length = 298 Score = 26.6 bits (56), Expect = 9.4 Identities = 12/43 (27%), Positives = 24/43 (55%) Query: 61 ELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHL 103 E E+++KR+ + E +++ + + + + EEKRR E L Sbjct: 87 ESMEEDREKRRREKEEEERLKRAEEEKRREEKRREEKRREEEL 129 >SB_58489| Best HMM Match : Ank (HMM E-Value=4.7e-08) Length = 1188 Score = 26.6 bits (56), Expect = 9.4 Identities = 23/96 (23%), Positives = 51/96 (53%), Gaps = 6/96 (6%) Query: 46 QKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQ 105 Q ++ ++ I EK ELS +E+Q ++ K + K + +T Q ++ E+ E++ Q Sbjct: 331 QIVLQQQQQIAEKEQELSTKERQLQEIKKRAQNK-INNTYIKQLETQVQEQ---NENMRQ 386 Query: 106 MNQILAKQVTEMSKIIAVKAWEELPLNQSDHEAEDR 141 + Q+L T+ +II +EL + ++ ++++ Sbjct: 387 LRQLLCD--TDEIRIINSALVKELEVVEAQFASKEQ 420 >SB_47780| Best HMM Match : CBM_3 (HMM E-Value=1.8) Length = 597 Score = 26.6 bits (56), Expect = 9.4 Identities = 12/28 (42%), Positives = 16/28 (57%) Query: 46 QKIVIPERYIPEKPPELSPEEQQKRQEK 73 Q I PE Y+PEK + S E+Q + K Sbjct: 429 QNISYPEGYVPEKKDKTSIEQQAPQAAK 456 >SB_42381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 26.6 bits (56), Expect = 9.4 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Query: 29 RDLRRADNTIDQLLAAPQKIVIPERYIPEK-PPELSPEEQQKRQEKVESIKKMLTSTSAD 87 R L +A +++ + + I EK PE E+QQK+ E+ ++++K T S Sbjct: 70 RKLAKASEILERSTTMERDVSDNLEKIQEKLGPEEHDEKQQKKDEREDTLEKRNTYKSES 129 Query: 88 QS 89 Q+ Sbjct: 130 QA 131 >SB_38330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 26.6 bits (56), Expect = 9.4 Identities = 15/66 (22%), Positives = 31/66 (46%) Query: 48 IVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMN 107 I I R E+ E+ EE+++ +E+ E ++ ++ + + EE+ E + Sbjct: 121 ITIKRRRREEEEEEVEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEDDDD 180 Query: 108 QILAKQ 113 +AKQ Sbjct: 181 DEVAKQ 186 >SB_35649| Best HMM Match : M (HMM E-Value=6e-09) Length = 1279 Score = 26.6 bits (56), Expect = 9.4 Identities = 18/84 (21%), Positives = 42/84 (50%), Gaps = 2/84 (2%) Query: 63 SPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKIIA 122 S E + +Q ++ES++ + S + +++ EEK + + ++ L +V E+ + + Sbjct: 870 SNEHSKSQQSEIESLRSQIESLNKFYNENQSAEEKLQGQR--EVLDSLNAKVKELEEQLE 927 Query: 123 VKAWEELPLNQSDHEAEDRSPDVE 146 +K + L + EAE+ + E Sbjct: 928 LKDSDLEVLRRDFKEAENSKLETE 951 >SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) Length = 709 Score = 26.6 bits (56), Expect = 9.4 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Query: 65 EEQQKRQEKVESIKKMLTSTSA--DQSKSPQPEEKRRREHL 103 E QQ++Q++ E K++T T + + +PQPE+ + L Sbjct: 489 EPQQQQQQQQEDQPKVVTQTQSLEETPPAPQPEDHTQEPEL 529 >SB_25350| Best HMM Match : Collagen (HMM E-Value=0) Length = 1112 Score = 26.6 bits (56), Expect = 9.4 Identities = 12/39 (30%), Positives = 23/39 (58%) Query: 50 IPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQ 88 + E + + P L P ++++R + +ES++KM T DQ Sbjct: 340 LEELALGDPPANLDPLDEKERLDFLESLEKMETLDPRDQ 378 >SB_20537| Best HMM Match : Vicilin_N (HMM E-Value=2.6) Length = 624 Score = 26.6 bits (56), Expect = 9.4 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 5/86 (5%) Query: 23 RSALPPRDLRRADNTIDQLLAAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLT 82 + AL +R+ +QLL Q+I ++ E E++ EE +EK I + +T Sbjct: 35 KEALLEERIRKIREKNEQLLKRQQEIEDDIKHAEEHSKEIAREE----EEKAPLIGQKMT 90 Query: 83 STSADQSKSPQPEEKRRREHLLQMNQ 108 D+ K P + + R L +M++ Sbjct: 91 GVRMDE-KPPSTKGRARGRVLAKMSR 115 >SB_20363| Best HMM Match : Involucrin (HMM E-Value=0.31) Length = 353 Score = 26.6 bits (56), Expect = 9.4 Identities = 14/48 (29%), Positives = 24/48 (50%) Query: 61 ELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQ 108 E PE+Q+ +QE +S K+ + +QS S ++ E L +Q Sbjct: 230 ERKPEQQENQQESGKSGKQPTEGDAREQSPSQSGSKQPNSEELQSTHQ 277 >SB_18982| Best HMM Match : M (HMM E-Value=1.1e-06) Length = 825 Score = 26.6 bits (56), Expect = 9.4 Identities = 12/32 (37%), Positives = 19/32 (59%) Query: 56 PEKPPELSPEEQQKRQEKVESIKKMLTSTSAD 87 PE+P E+S E+ + R E +E+ K+ L D Sbjct: 179 PEQPEEMSKEDLKARLEALENEKQELLEDKKD 210 >SB_13921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 688 Score = 26.6 bits (56), Expect = 9.4 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Query: 66 EQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTE 116 E Q+ +EK E +K S +K P+P +K+ E + + L K VT+ Sbjct: 223 EPQRLEEKEEKQRKRTKSRGVSPNKEPKP-KKKSSEPVQNPSYDLYKPVTK 272 >SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) Length = 2123 Score = 26.6 bits (56), Expect = 9.4 Identities = 14/48 (29%), Positives = 24/48 (50%) Query: 61 ELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMNQ 108 E PE+Q+ +QE +S K+ + +QS S ++ E L +Q Sbjct: 508 ERKPEQQENQQESGKSGKQPTEGDAREQSPSQSGSKQPNSEELQSTHQ 555 >SB_9343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 786 Score = 26.6 bits (56), Expect = 9.4 Identities = 18/80 (22%), Positives = 35/80 (43%), Gaps = 8/80 (10%) Query: 45 PQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLL 104 P++ +I P PE+ PE+Q+ E+ TS S D + + ++ L+ Sbjct: 423 PEETIIAPPSPPPAQPEVEPEQQESSDEE--------TSVSNDSEAERAEKLSQLQQQLI 474 Query: 105 QMNQILAKQVTEMSKIIAVK 124 +++ L+K E + K Sbjct: 475 SVHEQLSKLTGESVLVTKTK 494 >SB_3000| Best HMM Match : Extensin_2 (HMM E-Value=0.058) Length = 1002 Score = 26.6 bits (56), Expect = 9.4 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 120 IIAVKAWEELPLNQSDHEAEDRSPDVELP 148 ++++ E+ PL+ D E ED + D +LP Sbjct: 149 LLSIPTMEDEPLDFDDDENEDETSDFDLP 177 >SB_48178| Best HMM Match : RVT_1 (HMM E-Value=0.013) Length = 1105 Score = 26.6 bits (56), Expect = 9.4 Identities = 14/46 (30%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Query: 59 PPE--LSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREH 102 PPE +SP Q+ ++E V ++KML + D++ + +++ R E+ Sbjct: 435 PPEDEISPPSQRGQKELVRLLEKMLRNRLPDKTLKEKLDKQDRPEN 480 >SB_40403| Best HMM Match : Vicilin_N (HMM E-Value=0.012) Length = 1119 Score = 26.6 bits (56), Expect = 9.4 Identities = 25/104 (24%), Positives = 45/104 (43%), Gaps = 5/104 (4%) Query: 20 DVVRSALPPRDLRRADNTIDQLLAAPQKIVIPERY---IPEKPPELSPEEQQKRQEKVES 76 DV ++ +P + R I+ L + P P R + PP S E + +E ++ Sbjct: 928 DVKKNPVPNKIQMRKAPVINAL-SKPAAAAAPSRQPGPVQSTPPTSSMEPKPAIKEPAKT 986 Query: 77 IKKMLTSTSADQSKSPQPEEKRRREHLLQMNQILAKQVTEMSKI 120 + ++ K Q EE+ R+E ++ AK+ T M+ I Sbjct: 987 AFHRKSFIELEREKELQREEELRKEREAVKQELAAKE-TAMTMI 1029 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 26.6 bits (56), Expect = 9.4 Identities = 15/55 (27%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Query: 43 AAPQKIVIPERYIPEKPPELSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEK 97 ++P PE + EKP +E++K +K + +K TS ++ +S++ E+K Sbjct: 461 SSPSTTSTPESF-EEKPKHARNKEKKKEVKKKKGKEKSTTSGTSKKSEAEIQEKK 514 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 26.6 bits (56), Expect = 9.4 Identities = 18/106 (16%), Positives = 49/106 (46%), Gaps = 1/106 (0%) Query: 3 RSVDDADMERALRGAAPDVVR-SALPPRDLRRADNTIDQLLAAPQKIVIPERYIPEKPPE 61 R ++ + +R AA + R A ++ R + ++ +++ +R ++ + Sbjct: 323 RQKEEKEKQRLEAKAAKEKERLEAKQKKEQERLEKQAEKEKKEKERLEKKQREEKDRLEK 382 Query: 62 LSPEEQQKRQEKVESIKKMLTSTSADQSKSPQPEEKRRREHLLQMN 107 +E++KR+++ E K+ ++ K + EEK +++ + N Sbjct: 383 KEKKEEEKRKKEEEINAKIEEKKKREEKKKQEEEEKMKKKEQAKNN 428 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 26.6 bits (56), Expect = 9.4 Identities = 12/32 (37%), Positives = 19/32 (59%) Query: 56 PEKPPELSPEEQQKRQEKVESIKKMLTSTSAD 87 PE+P E+S E+ + R E +E+ K+ L D Sbjct: 157 PEQPEEMSKEDLKARLEALENEKQELLEDKKD 188 >SB_5548| Best HMM Match : PT (HMM E-Value=3.1) Length = 157 Score = 26.6 bits (56), Expect = 9.4 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Query: 51 PERYIPEKPPELSPEE--QQKRQEKVESIKKMLTSTSADQSKSPQPEEK 97 PE+ PE PE PE+ + K+++K E ++ + +PEEK Sbjct: 95 PEKK-PEDKPEDKPEDKPEDKQEDKPEDKQEDKPEAKPEDKPEDEPEEK 142 >SB_3143| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 26.6 bits (56), Expect = 9.4 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Query: 49 VIPERYIPEKPPELSPEEQQKR-QEKVESIKKMLTSTSADQSK 90 ++ E Y +K + S E+QK +E+ E+ +TS + D+SK Sbjct: 200 LVTETYQEQKSYQNSDYERQKSDRERTEAESSQITSRNTDESK 242 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.311 0.127 0.348 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,319,550 Number of Sequences: 59808 Number of extensions: 210375 Number of successful extensions: 1557 Number of sequences better than 10.0: 148 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 87 Number of HSP's that attempted gapping in prelim test: 1290 Number of HSP's gapped (non-prelim): 335 length of query: 158 length of database: 16,821,457 effective HSP length: 77 effective length of query: 81 effective length of database: 12,216,241 effective search space: 989515521 effective search space used: 989515521 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -