BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000202-TA|BGIBMGA000202-PA|undefined (136 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR533448-1|CAG38479.1| 119|Homo sapiens NDUFC2 protein. 29 4.0 BC007323-1|AAH07323.1| 119|Homo sapiens NADH dehydrogenase (ubi... 29 4.0 AF369951-1|AAM21294.1| 119|Homo sapiens lung cancer oncogene 1 ... 29 4.0 AF087899-1|AAP97198.1| 119|Homo sapiens NADH dehydrogenase prot... 29 4.0 AF087659-1|AAD09754.1| 119|Homo sapiens NADH-ubiquinone oxidore... 29 4.0 >CR533448-1|CAG38479.1| 119|Homo sapiens NDUFC2 protein. Length = 119 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Query: 30 AVKDRENLWGFLKKISLDVPDEDKEFYSALPGQLSP 65 AV+DRE ++G++K D P+EDK+ Y + + P Sbjct: 83 AVRDRE-MFGYMKLHPEDFPEEDKKTYGEIFEKFHP 117 >BC007323-1|AAH07323.1| 119|Homo sapiens NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa protein. Length = 119 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Query: 30 AVKDRENLWGFLKKISLDVPDEDKEFYSALPGQLSP 65 AV+DRE ++G++K D P+EDK+ Y + + P Sbjct: 83 AVRDRE-MFGYMKLHPEDFPEEDKKTYGEIFEKFHP 117 >AF369951-1|AAM21294.1| 119|Homo sapiens lung cancer oncogene 1 protein. Length = 119 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Query: 30 AVKDRENLWGFLKKISLDVPDEDKEFYSALPGQLSP 65 AV+DRE ++G++K D P+EDK+ Y + + P Sbjct: 83 AVRDRE-MFGYMKLHPEDFPEEDKKTYGEIFEKFHP 117 >AF087899-1|AAP97198.1| 119|Homo sapiens NADH dehydrogenase protein. Length = 119 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Query: 30 AVKDRENLWGFLKKISLDVPDEDKEFYSALPGQLSP 65 AV+DRE ++G++K D P+EDK+ Y + + P Sbjct: 83 AVRDRE-MFGYMKLHPEDFPEEDKKTYGEIFEKFHP 117 >AF087659-1|AAD09754.1| 119|Homo sapiens NADH-ubiquinone oxidoreductase B14.5B subunit protein. Length = 119 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Query: 30 AVKDRENLWGFLKKISLDVPDEDKEFYSALPGQLSP 65 AV+DRE ++G++K D P+EDK+ Y + + P Sbjct: 83 AVRDRE-MFGYMKLHPEDFPEEDKKTYGEIFEKFHP 117 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.320 0.140 0.438 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,594,959 Number of Sequences: 224733 Number of extensions: 501521 Number of successful extensions: 791 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 791 Number of HSP's gapped (non-prelim): 5 length of query: 136 length of database: 73,234,838 effective HSP length: 82 effective length of query: 54 effective length of database: 54,806,732 effective search space: 2959563528 effective search space used: 2959563528 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -