BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000202-TA|BGIBMGA000202-PA|undefined
(136 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPCC16C4.05 |||RNase P and RNase MRP subunit |Schizosaccharomyce... 24 9.5
>SPCC16C4.05 |||RNase P and RNase MRP subunit |Schizosaccharomyces
pombe|chr 3|||Manual
Length = 201
Score = 23.8 bits (49), Expect = 9.5
Identities = 9/32 (28%), Positives = 18/32 (56%)
Query: 29 LAVKDRENLWGFLKKISLDVPDEDKEFYSALP 60
+AV+D LW +LK + +++ + + S P
Sbjct: 136 IAVQDDSPLWKYLKDLVMNIEEPQARWLSENP 167
Database: spombe
Posted date: Oct 3, 2007 3:31 PM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.320 0.140 0.438
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 524,021
Number of Sequences: 5004
Number of extensions: 16412
Number of successful extensions: 33
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 32
Number of HSP's gapped (non-prelim): 1
length of query: 136
length of database: 2,362,478
effective HSP length: 66
effective length of query: 70
effective length of database: 2,032,214
effective search space: 142254980
effective search space used: 142254980
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 49 (23.8 bits)
- SilkBase 1999-2023 -