BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000202-TA|BGIBMGA000202-PA|undefined (136 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC16C4.05 |||RNase P and RNase MRP subunit |Schizosaccharomyce... 24 9.5 >SPCC16C4.05 |||RNase P and RNase MRP subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 201 Score = 23.8 bits (49), Expect = 9.5 Identities = 9/32 (28%), Positives = 18/32 (56%) Query: 29 LAVKDRENLWGFLKKISLDVPDEDKEFYSALP 60 +AV+D LW +LK + +++ + + S P Sbjct: 136 IAVQDDSPLWKYLKDLVMNIEEPQARWLSENP 167 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.320 0.140 0.438 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 524,021 Number of Sequences: 5004 Number of extensions: 16412 Number of successful extensions: 33 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 32 Number of HSP's gapped (non-prelim): 1 length of query: 136 length of database: 2,362,478 effective HSP length: 66 effective length of query: 70 effective length of database: 2,032,214 effective search space: 142254980 effective search space used: 142254980 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -