BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000201-TA|BGIBMGA000201-PA|IPR001353|20S proteasome, A and B subunits (232 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 23 2.0 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 3.5 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 23.0 bits (47), Expect = 2.0 Identities = 8/15 (53%), Positives = 12/15 (80%) Query: 115 LYYKRFFPYYVSNVL 129 +++KRF P YVS +L Sbjct: 168 VFFKRFLPVYVSYLL 182 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 3.5 Identities = 16/51 (31%), Positives = 22/51 (43%) Query: 145 PIGHCARHNFRAGGSAAAQLQPLLDNQIGLKNMQNVTEAPLPREKALALLK 195 PIG F A +AA+ L P ++ L N + P P + AL K Sbjct: 280 PIGASHLPYFAAAVAAASNLSPKTNSSPDLWNGKLKHGGPTPSDATKALEK 330 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 51,460 Number of Sequences: 317 Number of extensions: 1971 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 232 length of database: 114,650 effective HSP length: 55 effective length of query: 177 effective length of database: 97,215 effective search space: 17207055 effective search space used: 17207055 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -