Silkworm BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000201-TA|BGIBMGA000201-PA|IPR001353|20S proteasome, A
and B subunits
         (232 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF532982-1|AAQ10289.1|  459|Anopheles gambiae putative RNA methy...    25   2.5  

>AF532982-1|AAQ10289.1|  459|Anopheles gambiae putative RNA
           methylase protein.
          Length = 459

 Score = 24.6 bits (51), Expect = 2.5
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 21  FEPYADNGGSIVAIAGDDYAVIGADT--RLSTGFSIYTRDQKKLFKLSES 68
           F+P+A +G  +VA A     V GAD    +  G S  TR  +K+ +  ES
Sbjct: 222 FDPFAGSGSLLVAAAKFGAYVAGADIDYMIVHGKSKPTRVNQKVREKDES 271


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.319    0.135    0.395 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 233,032
Number of Sequences: 2123
Number of extensions: 8563
Number of successful extensions: 15
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 14
Number of HSP's gapped (non-prelim): 1
length of query: 232
length of database: 516,269
effective HSP length: 62
effective length of query: 170
effective length of database: 384,643
effective search space: 65389310
effective search space used: 65389310
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 47 (23.0 bits)