BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000201-TA|BGIBMGA000201-PA|IPR001353|20S proteasome, A
and B subunits
(232 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 25 2.5
>AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA
methylase protein.
Length = 459
Score = 24.6 bits (51), Expect = 2.5
Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
Query: 21 FEPYADNGGSIVAIAGDDYAVIGADT--RLSTGFSIYTRDQKKLFKLSES 68
F+P+A +G +VA A V GAD + G S TR +K+ + ES
Sbjct: 222 FDPFAGSGSLLVAAAKFGAYVAGADIDYMIVHGKSKPTRVNQKVREKDES 271
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.319 0.135 0.395
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 233,032
Number of Sequences: 2123
Number of extensions: 8563
Number of successful extensions: 15
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 14
Number of HSP's gapped (non-prelim): 1
length of query: 232
length of database: 516,269
effective HSP length: 62
effective length of query: 170
effective length of database: 384,643
effective search space: 65389310
effective search space used: 65389310
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 47 (23.0 bits)
- SilkBase 1999-2023 -