BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000199-TA|BGIBMGA000199-PA|undefined (114 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0612 - 19228262-19228570,19229955-19230404 28 2.0 05_02_0040 + 5904169-5904304,5904382-5904938 27 2.7 09_06_0363 - 22551848-22552915 27 4.7 01_06_0293 - 28254673-28254878,28255189-28255306,28255767-282559... 26 6.2 04_04_0214 - 23674270-23676858,23677574-23680843,23680941-236811... 26 8.2 >10_08_0612 - 19228262-19228570,19229955-19230404 Length = 252 Score = 27.9 bits (59), Expect = 2.0 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 11/59 (18%) Query: 9 LPLPNLKVYTAGSVLLLSIAVYHATIVTSDPNWRANITLQRQEALAEPDGEAQLVDQAE 67 +P P L+VYT+ +L +A H V+S EA+A PDGE V++ E Sbjct: 32 IPPPRLRVYTSHRLLSSLLAPSHVPAVSS-----------LAEAVAAPDGEGVEVEEEE 79 >05_02_0040 + 5904169-5904304,5904382-5904938 Length = 230 Score = 27.5 bits (58), Expect = 2.7 Identities = 24/96 (25%), Positives = 44/96 (45%), Gaps = 2/96 (2%) Query: 12 PNLKVYTAGSVLLLSIAVYHATIVTSDPNWRANI-TLQRQEALAEPDGEAQLVDQAEVMP 70 P+ + + ++L+ AVY VTS P+ R L+R + A P G + P Sbjct: 118 PHYHPRASETAVVLAGAVYFG-FVTSYPDSRVVAKVLRRGDVFAVPQGLVHFLHNNGSEP 176 Query: 71 ALNLNATRNLNERMVVIITFMMQEPLCMWVVIKCLV 106 A + + N +V++ ++ PL + +V K L+ Sbjct: 177 AALYASLSSQNPGLVLVADALLAAPLPVDLVAKTLL 212 >09_06_0363 - 22551848-22552915 Length = 355 Score = 26.6 bits (56), Expect = 4.7 Identities = 14/40 (35%), Positives = 22/40 (55%) Query: 29 VYHATIVTSDPNWRANITLQRQEALAEPDGEAQLVDQAEV 68 V +T++ SDP RA +T LAE + E + +A+V Sbjct: 206 VSSSTVLVSDPGLRARLTHMGAAQLAELEDEEEPSREADV 245 >01_06_0293 - 28254673-28254878,28255189-28255306,28255767-28255961, 28256701-28256800,28256887-28256972,28257078-28257239, 28257965-28258101,28258233-28258281,28258688-28258746, 28258862-28258896,28259384-28259433,28260173-28260332, 28260898-28260963,28261065-28261162,28261649-28261696, 28262114-28262242,28262667-28262769,28262858-28262954, 28263181-28263241,28263659-28263740,28263845-28263962, 28264039-28266325 Length = 1481 Score = 26.2 bits (55), Expect = 6.2 Identities = 17/61 (27%), Positives = 34/61 (55%), Gaps = 4/61 (6%) Query: 44 NITLQRQEA---LAEPDGEAQLVDQAEVMPA-LNLNATRNLNERMVVIITFMMQEPLCMW 99 N TL ++A L++ +GE Q +++A ++PA L + + E++ V + + + L W Sbjct: 420 NATLGPEDAVTGLSQQEGEVQELEEATLLPASLAFERSDSFQEKITVEMKKELSDFLPSW 479 Query: 100 V 100 V Sbjct: 480 V 480 >04_04_0214 - 23674270-23676858,23677574-23680843,23680941-23681119, 23681200-23681559,23681645-23682086,23682199-23682332, 23682479-23682680 Length = 2391 Score = 25.8 bits (54), Expect = 8.2 Identities = 15/61 (24%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Query: 5 LVDRLP-LPNLKVYTAGSVLLLSIAVYHATIVTSDPNWRANITLQRQEALAEPDGEAQLV 63 + + +P P K++ +G + V H+ +++D + R + L++ DGEA L+ Sbjct: 1837 MYEEIPSFPRHKIFASGKSF--PVIVRHSNSLSADDDARLDARGAAVRILSDNDGEAPLL 1894 Query: 64 D 64 D Sbjct: 1895 D 1895 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.321 0.134 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,012,197 Number of Sequences: 37544 Number of extensions: 94479 Number of successful extensions: 197 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 195 Number of HSP's gapped (non-prelim): 5 length of query: 114 length of database: 14,793,348 effective HSP length: 73 effective length of query: 41 effective length of database: 12,052,636 effective search space: 494158076 effective search space used: 494158076 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -