Silkworm BLAST Result against fruitfly

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000199-TA|BGIBMGA000199-PA|undefined
         (114 letters)

Database: fruitfly 
           52,641 sequences; 24,830,863 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014297-672|AAF54166.1|  965|Drosophila melanogaster CG10445-PA...    27   5.9  

>AE014297-672|AAF54166.1|  965|Drosophila melanogaster CG10445-PA
          protein.
          Length = 965

 Score = 27.1 bits (57), Expect = 5.9
 Identities = 13/56 (23%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 42 RANITLQRQEALAEPDGEAQLVDQAEVMP--ALNLNATRNLNERMVVIITFMMQEP 95
          + + ++Q Q ++  PD   ++ +  E  P  +L L+  +NL   M +++T++   P
Sbjct: 14 KQSCSIQDQSSVPVPDSSGEINNWMEPEPVDSLELSGGKNLEHAMPLLLTYLDLSP 69


  Database: fruitfly
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 24,830,863
  Number of sequences in database:  52,641
  
Lambda     K      H
   0.321    0.134    0.407 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,054,576
Number of Sequences: 52641
Number of extensions: 167743
Number of successful extensions: 505
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 505
Number of HSP's gapped (non-prelim): 1
length of query: 114
length of database: 24,830,863
effective HSP length: 75
effective length of query: 39
effective length of database: 20,882,788
effective search space: 814428732
effective search space used: 814428732
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 56 (26.6 bits)