BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000197-TA|BGIBMGA000197-PA|IPR003754|Uroporphyrinogen III synthase HEM4 (248 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 22 4.6 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 6.0 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/40 (25%), Positives = 20/40 (50%) Query: 27 VEPLQFIYINIEELSQKLLQNDYDGMILTSPRAVEAVSKC 66 ++ LQ I + SQK++ Y+G + V++ +C Sbjct: 26 IQTLQPICVGETGTSQKIIDEVYNGNVNVEDENVQSYVEC 65 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Query: 201 SLLPHFAIGNSTAHKIENL 219 SL+PH A STAH + L Sbjct: 102 SLVPHMAWQLSTAHLLAQL 120 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.133 0.374 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,510 Number of Sequences: 429 Number of extensions: 2451 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 248 length of database: 140,377 effective HSP length: 56 effective length of query: 192 effective length of database: 116,353 effective search space: 22339776 effective search space used: 22339776 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -