BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000194-TA|BGIBMGA000194-PA|undefined (271 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 27 0.15 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 21 9.8 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 27.1 bits (57), Expect = 0.15 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 5/40 (12%) Query: 116 VDNKFIKDKWVEILKGNGLE-YKD----FSTTDNTNWYGT 150 + NK+ + K V + NGL+ Y D FS+ +NTNW T Sbjct: 774 IPNKYYEAKQVYRIGSNGLQCYIDRNVVFSSQNNTNWVPT 813 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 131 GNGLEYKDFSTTDNTNWYGTMG 152 GNGLE + D ++W+ G Sbjct: 276 GNGLETSWGKSRDESSWFYNSG 297 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.135 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,189 Number of Sequences: 317 Number of extensions: 2110 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 271 length of database: 114,650 effective HSP length: 56 effective length of query: 215 effective length of database: 96,898 effective search space: 20833070 effective search space used: 20833070 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -