BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000193-TA|BGIBMGA000193-PA|IPR013106|Immunoglobulin V-set, IPR007110|Immunoglobulin-like, IPR003599|Immunoglobulin subtype (202 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 26 0.24 AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochr... 23 1.7 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 2.2 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 6.8 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 25.8 bits (54), Expect = 0.24 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 135 HSEGSDDWILQIKYVQKRDNGTYECQVSTCQLS 167 H ++ +L+I+ V+K D G Y+C + Q S Sbjct: 366 HPIDHNEAVLRIESVRKEDKGMYQCFIRNDQES 398 Score = 21.0 bits (42), Expect = 6.8 Identities = 8/21 (38%), Positives = 12/21 (57%) Query: 140 DDWILQIKYVQKRDNGTYECQ 160 +D L I +QK + G Y C+ Sbjct: 756 EDGTLTINNIQKTNEGYYLCE 776 >AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q3 protein. Length = 143 Score = 23.0 bits (47), Expect = 1.7 Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 69 LDALHREPSINNTQE 83 L LHR+P+ NN QE Sbjct: 47 LGDLHRKPTYNNLQE 61 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.6 bits (46), Expect = 2.2 Identities = 14/64 (21%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Query: 92 VAFLHCPVRNLGERGVSWVRRRDWHIISSGVLMYTNDERFQV-LHSEGSDDWILQIKYVQ 150 +AF + P++ L + ++R+ ++ S V ++ V + E +L I + Sbjct: 131 IAFYYKPIKTLNGHEIKFIRKEEYISFESKVFHKLKKMKYLVEVQDEVKPRGVLNI--IP 188 Query: 151 KRDN 154 K+DN Sbjct: 189 KQDN 192 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.0 bits (42), Expect = 6.8 Identities = 6/17 (35%), Positives = 9/17 (52%) Query: 171 EPSPTVPASTMTCNRQP 187 +P P +P + CN P Sbjct: 159 DPGPALPPTGFLCNNYP 175 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.131 0.415 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 41,047 Number of Sequences: 317 Number of extensions: 1652 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 202 length of database: 114,650 effective HSP length: 54 effective length of query: 148 effective length of database: 97,532 effective search space: 14434736 effective search space used: 14434736 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -