BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000192-TA|BGIBMGA000192-PA|undefined (176 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 22 3.3 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 21 4.3 Z69742-1|CAA93624.1| 72|Tribolium castaneum arylphorin protein. 20 9.9 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.8 bits (44), Expect = 3.3 Identities = 9/25 (36%), Positives = 15/25 (60%) Query: 93 FQSALLTPDIRALRYVDAKVSGWVE 117 + SA+ T + L VDA + GW++ Sbjct: 224 YPSAVDTTTNQKLLTVDAAIRGWIQ 248 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.4 bits (43), Expect = 4.3 Identities = 9/32 (28%), Positives = 16/32 (50%) Query: 93 FQSALLTPDIRALRYVDAKVSGWVELNFREGR 124 + S++ + L VDA + GW+E G+ Sbjct: 228 YASSIDVEGSQKLLNVDASIRGWIERGADPGK 259 >Z69742-1|CAA93624.1| 72|Tribolium castaneum arylphorin protein. Length = 72 Score = 20.2 bits (40), Expect = 9.9 Identities = 6/14 (42%), Positives = 9/14 (64%) Query: 24 VIFVPRAVWIRFEQ 37 ++ V R VW+ F Q Sbjct: 27 IVVVVRGVWVSFNQ 40 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.134 0.420 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 41,186 Number of Sequences: 317 Number of extensions: 1507 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 176 length of database: 114,650 effective HSP length: 53 effective length of query: 123 effective length of database: 97,849 effective search space: 12035427 effective search space used: 12035427 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.5 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -