BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000192-TA|BGIBMGA000192-PA|undefined (176 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1039.08 |||serine acetyltransferase |Schizosaccharomyces pom... 33 0.018 SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces ... 27 1.2 SPAC2E1P3.04 |||copper amine oxidase |Schizosaccharomyces pombe|... 26 3.6 >SPAC1039.08 |||serine acetyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 270 Score = 33.5 bits (73), Expect = 0.018 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 8/84 (9%) Query: 25 IFVPRAVWIRFEQERSASPEINPRLR--LTKADVTKKNHEINLCPTAMRDCVLVKRKEKA 82 I + +A+W + +E E+NP L L + ++KK +L CVL + Sbjct: 10 ITLVQAIWPKLRKEAEKQCEVNPWLAKDLARKILSKKTLRESL------SCVLALPLDHV 63 Query: 83 TACSLAMQSWFQSALLTPDIRALR 106 T S +M++WF S L D + +R Sbjct: 64 TGSSESMENWFYSILGLNDEKIIR 87 >SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1427 Score = 27.5 bits (58), Expect = 1.2 Identities = 8/30 (26%), Positives = 18/30 (60%) Query: 5 IATIHLVQAGVPTGDVSWLVIFVPRAVWIR 34 + +H++ + T +S + +VP+A W+R Sbjct: 628 LGELHVISGKMTTPSISQRIAYVPQAAWLR 657 >SPAC2E1P3.04 |||copper amine oxidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 712 Score = 25.8 bits (54), Expect = 3.6 Identities = 12/48 (25%), Positives = 22/48 (45%) Query: 28 PRAVWIRFEQERSASPEINPRLRLTKADVTKKNHEINLCPTAMRDCVL 75 P + + E+ + R+ LTKA+V + H +CP D ++ Sbjct: 78 PERIALAVLLEKGVPGILEARVNLTKAEVIQIEHITGVCPILTADMLV 125 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.322 0.134 0.420 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 800,121 Number of Sequences: 5004 Number of extensions: 29236 Number of successful extensions: 62 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 58 Number of HSP's gapped (non-prelim): 3 length of query: 176 length of database: 2,362,478 effective HSP length: 68 effective length of query: 108 effective length of database: 2,022,206 effective search space: 218398248 effective search space used: 218398248 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -