BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000190-TA|BGIBMGA000190-PA|undefined (99 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 23 0.45 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 20 4.2 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 20 5.5 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 19 7.3 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 19 9.7 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 23.4 bits (48), Expect = 0.45 Identities = 10/30 (33%), Positives = 17/30 (56%) Query: 52 VDYVPGPLAVVNAGMVTASTVKTYVSVVGW 81 +D G +A +NA V +KT +++ GW Sbjct: 76 LDVDAGTIAKLNALKVKNPNLKTLIAIGGW 105 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 20.2 bits (40), Expect = 4.2 Identities = 10/30 (33%), Positives = 15/30 (50%) Query: 52 VDYVPGPLAVVNAGMVTASTVKTYVSVVGW 81 +D G L NA + +KT V++ GW Sbjct: 72 LDVNQGNLKKFNALKLKNPNLKTLVAIGGW 101 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 19.8 bits (39), Expect = 5.5 Identities = 10/29 (34%), Positives = 13/29 (44%) Query: 53 DYVPGPLAVVNAGMVTASTVKTYVSVVGW 81 D G A V A +KT +S+ GW Sbjct: 77 DIEKGNFAEVEALKEINPNLKTIISIGGW 105 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 19.4 bits (38), Expect = 7.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Query: 6 VGVLMNLPLHGAQVW 20 V V +NLP QVW Sbjct: 160 VAVKINLPESRVQVW 174 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 19.0 bits (37), Expect = 9.7 Identities = 7/13 (53%), Positives = 9/13 (69%) Query: 4 MYVGVLMNLPLHG 16 M V V MN+ +HG Sbjct: 147 MSVNVSMNMTMHG 159 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.326 0.139 0.444 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,681 Number of Sequences: 317 Number of extensions: 342 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 99 length of database: 114,650 effective HSP length: 48 effective length of query: 51 effective length of database: 99,434 effective search space: 5071134 effective search space used: 5071134 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (20.2 bits) S2: 37 (19.0 bits)
- SilkBase 1999-2023 -